Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cystatin C/CST3 (Human Cells)

Source: Human Cells. MW :13.3kD. Recombinant Human Cystatin C is produced by our Mammalian expression system and the target gene encoding Ser27-Ala146 is expressed. Cystatin C is a member of family 2 of the cystatin superfamily. It is ubiquitous in human tissues and body fluids and mainly used as a biomarker of kidney function. Cystatin C inhibits many cysteine proteases such as papain and Cathepsins B, H, K, L and S. As an inhibitor of cysteine proteinases, Cystatin C is thought to serve an important physiological role as a local regulator of this enzyme activity. Recently, it has been studied for its role in predicting new-onset or deteriorating cardiovascular disease. It also seems to play a role in brain disorders involving amyloid (a specific type of protein deposition), such as Alzheimer's disease.

Product Specifications

Gene Name

CST3

Gene ID

1471

UniProt

P01034

Components

Lyophilized from a 0.2 μm filtered solution of 10mM PB, 200mM Nacl, pH6.5.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

BARX1 (C-term) Rabbit Polyclonal Antibody
AP14001PU-N 400 µL

BARX1 (C-term) Rabbit Polyclonal Antibody

Ask
View Details
MAYV-E2 Matched Antibody Pair Set [ABP-S-051051]
ABP-S-051051 5 Plates

MAYV-E2 Matched Antibody Pair Set [ABP-S-051051]

Ask
View Details
RSK1 p90 Blocking Peptide
MBS9616766-01 1 mg

RSK1 p90 Blocking Peptide

Ask
View Details
RSK1 p90 Blocking Peptide
MBS9616766-02 5x 1 mg

RSK1 p90 Blocking Peptide

Ask
View Details
1,3-O-Benzylidene-D-arabitol
GC8272-5g 5 g

1,3-O-Benzylidene-D-arabitol

Ask
View Details