Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cynomolgus Fibroblast Growth Factor 21/FGF-21 (C-6His)

Source: Human Cells. MW :20.2kD. Recombinant Cynomolgus Fibroblast Growth Factor 21 (Accession No.-XM_005589811.2) is produced by our Mammalian expression system and the target gene encoding His29-Ser209 is expressed with a 6His tag at the C-terminus. Fibroblast Growth Factor 21 (FGF21) is a growth factor that belongs to the FGF family. FGF family proteins play a central role during prenatal development and postnatal growth and regeneration of mamy tissues, by promoting cellular proliferation and differentiation. FGF21 is a potent activator of glucose uptake on adipocytes, protects animal from diet-induced obesity when overexpression in transgenic mice, and lower blood glucose and triglyceride levels when therapeutically adiministered to diabetic redents. FGF21 is produced by hepatocytes in reponse to free fatty acid stimulation of a PPARa/RXR dimeric complex. This situation occurs clinically during starvation, or following the ingestionof a highly-fat/low-carbohydrate diet. Upon FGF21 secretion, white adipose tissue is induced to release free fatty acids from triglyceride stores. Once free fatty acid reach hepatocytes, they are oxidized and reduced to acetyl-CoA. The acetyl-CoA is recombined into 4-carbon ketone bodies, release, and transported to peripheral tissue for TCA processing and energy generation.

Product Specifications

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAAHQSPESLLQLKALKPGVIQILGVKTSRFLCQKPDGALYGSLHFDPEACSFRELLLENGYNVYQSEAHGLPLHLPGNKSPHRDPASQGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQARSPSYASHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

Gspt1 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4711403 1.0 µg DNA

Gspt1 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
PDHA1 Mouse Monoclonal Antibody [Clone ID: OTI2C10]
TA502696S 30 µL

PDHA1 Mouse Monoclonal Antibody [Clone ID: OTI2C10]

Sign In for Pricing
View Details
FOXD2 Rabbit pAb
E47R21592 100 µL

FOXD2 Rabbit pAb

Sign In for Pricing
View Details
FANCC (Fanconi Anemia Group C Protein, Protein FACC, FAC, FACC) (FITC)
MBS6145642-01 0.1 mL

FANCC (Fanconi Anemia Group C Protein, Protein FACC, FAC, FACC) (FITC)

Sign In for Pricing
View Details
FANCC (Fanconi Anemia Group C Protein, Protein FACC, FAC, FACC) (FITC)
MBS6145642-02 5x 0.1 mL

FANCC (Fanconi Anemia Group C Protein, Protein FACC, FAC, FACC) (FITC)

Sign In for Pricing
View Details
ODC1 Antibody, HRP conjugated
A17254-100UG 100 µg

ODC1 Antibody, HRP conjugated

Sign In for Pricing
View Details