Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse RANK/TNFRSF11A (C-6His)

Source: Human Cells. MW :21.3kD. Recombinant Mouse Receptor Activator of NF-kappa B is produced by our Mammalian expression system and the target gene encoding Val31-Ser214 is expressed with a 6His tag at the C-terminus. Receptor activator of NF-?B (RANK, TNFRSF11A) belongs to one member of tumor necrosis factor receptor family.It is a receptor for TNFSF11/RANKL/TRANCE/OPGL. This gene encodes a type 1 membrane protein with a 30 amino acids (aa) signal peptide, 184 aa extracellular region , a 20 aa transmembrane domain and a 391 aa cytoplasmic region. Human and murine RANK share 81% aa identity in their extracellular domains. RANK is ubiquitous highly expressed in trabecular bone, thymus, small intestine, lung, brain and kidney, but weakly expressed in spleen and bone marrow. After binding its ligand RANKL, RANK can activate signaling pathways such as NF-?B, JNK, ERK, p38, and Akt/PKB, through TRAF protein phosphorylation. RANK/TNFRSF11A signaling is largely considered to be growth promoting and apoptosis reducing such as the effects observed in osteoclasts. RANK/TNFRSF11A was also found to be involved in the regulation of interactions between T-cells and dendritic cells.

Product Specifications

Gene Name

Tnfrsf11a

Gene ID

21934

UniProt

O35305

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

VTPPCTQERHYEHLGRCCSRCEPGKYLSSKCTPTSDSVCLPCGPDEYLDTWNEEDKCLLHKVCDAGKALVAVDPGNHTAPRRCACTAGYHWNSDCECCRRNTECAPGFGAQHPLQLNKDTVCTPCLLGFFSDVFSSTDKCKPWTNCTLLGKLEAHQGTTESDVVCSSSMTLRRPPKEAQAYLPSVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

A4GALT Antibody
A67699-100UL 100 µL

A4GALT Antibody

Ask
View Details
DNA-Directed RNA Polymerase II Subunit RPB7 (POLR2G) Antibody
abx006002-01 20 µL

DNA-Directed RNA Polymerase II Subunit RPB7 (POLR2G) Antibody

Ask
View Details
DNA-Directed RNA Polymerase II Subunit RPB7 (POLR2G) Antibody
abx006002-02 100 µL

DNA-Directed RNA Polymerase II Subunit RPB7 (POLR2G) Antibody

Ask
View Details
DNA-Directed RNA Polymerase II Subunit RPB7 (POLR2G) Antibody
abx006002-03 2x 100 µL

DNA-Directed RNA Polymerase II Subunit RPB7 (POLR2G) Antibody

Ask
View Details
RET Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-61292R-BF488-01 20 µL

RET Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Ask
View Details
RET Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-61292R-BF488-02 100 µL

RET Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Ask
View Details