Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse C-C motif chemokine 2/CCL2 (C-6His)

Source: Human cells. MW :14.7kD. Recombinant Mouse C-C motif chemokine 2 is produced by our Mammalian expression system and the target gene encoding Gln24-Asn148 is expressed with a 6His tag at the C-terminus. C-C motif chemokine 2 (CCL2) is a member of the C-C or beta chemokine family. Mouse CCL2 shares 82% amino acid (aa) identity with rat CCL2 over the entire sequence, and 58%, 56%, 55%, 53% and 53% aa identity with human, equine, porcine, bovine and canine CCL2, respectively. Fibroblasts, glioma cells, smooth muscle cells, endothelial cells, lymphocytes and mononuclear phagocytes can produce CCL2 either constitutively or upon mitogenic stimulation, but monocytes and macrophages appear to be the major source. In addition to its chemotactic activity, CCL2 induces enzyme and cytokine release by monocytes, NK cells and lymphocytes, and histamine release by basophils that express its receptor, CCR2. Additionally, it promotes Th2 polarization in CD4+ T cells. CCL2-mediated recruitment of monocytes to sites of inflammation is proposed to play a role in the pathology of atherosclerosis, multiple sclerosis and allergic asthma.

Product Specifications

Gene Name

Ccl2

Gene ID

20296

UniProt

P10148

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris, 500mM NaCl, 10% glycerol, pH7.4 .

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVNHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

EML1 shRNA Plasmid (h)
sc-60576-SH 20 µg

EML1 shRNA Plasmid (h)

Ask
View Details
Ipidacrine hydrochloride hydrate
M10628-01 1 g

Ipidacrine hydrochloride hydrate

Ask
View Details
Ipidacrine hydrochloride hydrate
M10628-02 100 mg

Ipidacrine hydrochloride hydrate

Ask
View Details
Ipidacrine hydrochloride hydrate
M10628-03 200 mg

Ipidacrine hydrochloride hydrate

Ask
View Details
Ipidacrine hydrochloride hydrate
M10628-04 500 mg

Ipidacrine hydrochloride hydrate

Ask
View Details
Ipidacrine hydrochloride hydrate
M10628-05 Inquire

Ipidacrine hydrochloride hydrate

Ask
View Details