Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Heparin Binding EGF like Growth Factor/proHB-EGF (C-6His)

Source: Human Cells. MW :15.1kD. Recombinant Human Heparin Binding EGF like Growth Factor is produced by our Mammalian expression system and the target gene encoding Leu20-Leu148 is expressed with a 6His tag at the C-terminus. Heparin-binding EGF-like growth factor (HB-EGF) is a 12­16 kDa member of the epidermal growth factor (EGF) family. It possesses an EGF­like domain, and a heparin-binding motif. Mature HB­EGF is a soluble peptide that arises from proteolytic processing of the transmembrane form. Human HB­EGF shows 76% and 73% aa sequence identity with rat and mouse HB­EGF, respectively. It is required for normal cardiac valve formation and normal heart function, promotes smooth muscle cell proliferation. It may be involved in macrophage-mediated cellular proliferation; it is mitogenic for fibroblasts, but not endothelial cells. HB­EGF classified as a group 2 ErbB ligand based on its ability to activate both the EGF/ErbB1 and ErbB4 receptors. Activity associated with ErbB4 binding appears to be limited to non­mitogenic actions, while EGFR binding induces both mitogenic and non­mitogenic activity.

Product Specifications

Gene Name

HBEGF

Gene ID

1839

UniProt

Q99075

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSLHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rac Ketoprofen β-D-Glucuronide Allyl Ester
015357 1 mg

Rac Ketoprofen β-D-Glucuronide Allyl Ester

Ask
View Details
Lentiviral mouse Marveld2 shRNA (UAS) - Lentiviral mouse Marveld2 shRNA (UAS) (25)
GTR15266933 1 Vial

Lentiviral mouse Marveld2 shRNA (UAS) - Lentiviral mouse Marveld2 shRNA (UAS) (25)

Ask
View Details
5-[ (Chloromethyl) sulfonyl]-1-phenyl-1H-tetrazole
434722-01 25 mg

5-[ (Chloromethyl) sulfonyl]-1-phenyl-1H-tetrazole

Ask
View Details
5-[ (Chloromethyl) sulfonyl]-1-phenyl-1H-tetrazole
434722-02 50 mg

5-[ (Chloromethyl) sulfonyl]-1-phenyl-1H-tetrazole

Ask
View Details
Lentiviral human MPI shRNA (UAS) - Lentiviral human MPI shRNA (UAS, RFP) plasmid
GTR15159313 1 Vial

Lentiviral human MPI shRNA (UAS) - Lentiviral human MPI shRNA (UAS, RFP) plasmid

Ask
View Details