Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Heparin Binding EGF like Growth Factor/proHB-EGF (C-6His)

Source: Human Cells. MW :15.1kD. Recombinant Human Heparin Binding EGF like Growth Factor is produced by our Mammalian expression system and the target gene encoding Leu20-Leu148 is expressed with a 6His tag at the C-terminus. Heparin-binding EGF-like growth factor (HB-EGF) is a 12­16 kDa member of the epidermal growth factor (EGF) family. It possesses an EGF­like domain, and a heparin-binding motif. Mature HB­EGF is a soluble peptide that arises from proteolytic processing of the transmembrane form. Human HB­EGF shows 76% and 73% aa sequence identity with rat and mouse HB­EGF, respectively. It is required for normal cardiac valve formation and normal heart function, promotes smooth muscle cell proliferation. It may be involved in macrophage-mediated cellular proliferation; it is mitogenic for fibroblasts, but not endothelial cells. HB­EGF classified as a group 2 ErbB ligand based on its ability to activate both the EGF/ErbB1 and ErbB4 receptors. Activity associated with ErbB4 binding appears to be limited to non­mitogenic actions, while EGFR binding induces both mitogenic and non­mitogenic activity.

Product Specifications

Gene Name

HBEGF

Gene ID

1839

UniProt

Q99075

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSLHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PLV3-CMV-AURKB-3xMyc-EF1a-CopGFP-Neo Plasmid
PVT75774 2 µg

PLV3-CMV-AURKB-3xMyc-EF1a-CopGFP-Neo Plasmid

Ask
View Details
ROR2 (Tyrosine-protein Kinase Transmembrane Receptor ROR2, Neurotrophic Tyrosine Kinase, Receptor-related 2, NTRKR2) (MaxLight 550) discontinued
R2999-61D-ML550 100 µL

ROR2 (Tyrosine-protein Kinase Transmembrane Receptor ROR2, Neurotrophic Tyrosine Kinase, Receptor-related 2, NTRKR2) (MaxLight 550) discontinued

Ask
View Details
USP45 Antibody, HRP conjugated
MBS7050462-01 0.05 mg

USP45 Antibody, HRP conjugated

Ask
View Details
USP45 Antibody, HRP conjugated
MBS7050462-02 0.1 mg

USP45 Antibody, HRP conjugated

Ask
View Details
USP45 Antibody, HRP conjugated
MBS7050462-03 5x 0.1 mg

USP45 Antibody, HRP conjugated

Ask
View Details
B4GALT5 (FITC)
556149-01 50 µg

B4GALT5 (FITC)

Ask
View Details