Recombinant Human Heparin Binding EGF like Growth Factor/proHB-EGF (C-6His)
Source: Human Cells. MW :15.1kD. Recombinant Human Heparin Binding EGF like Growth Factor is produced by our Mammalian expression system and the target gene encoding Leu20-Leu148 is expressed with a 6His tag at the C-terminus. Heparin-binding EGF-like growth factor (HB-EGF) is a 1216 kDa member of the epidermal growth factor (EGF) family. It possesses an EGFlike domain, and a heparin-binding motif. Mature HBEGF is a soluble peptide that arises from proteolytic processing of the transmembrane form. Human HBEGF shows 76% and 73% aa sequence identity with rat and mouse HBEGF, respectively. It is required for normal cardiac valve formation and normal heart function, promotes smooth muscle cell proliferation. It may be involved in macrophage-mediated cellular proliferation; it is mitogenic for fibroblasts, but not endothelial cells. HBEGF classified as a group 2 ErbB ligand based on its ability to activate both the EGF/ErbB1 and ErbB4 receptors. Activity associated with ErbB4 binding appears to be limited to nonmitogenic actions, while EGFR binding induces both mitogenic and nonmitogenic activity.
Product Specifications
Gene Name
HBEGF
Gene ID
1839
UniProt
Q99075
Components
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping Conditions
The product is shipped on dry ice/ice packs.
Storage Conditions
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
LVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSLHHHHHH
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items