Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse DNAX Accessory Molecule-1/DNAM-1/CD226 (C-6His)

Source: Human Cells. MW :27.6kD. Recombinant Mouse DNAX Accessory Molecule-1 is produced by our Mammalian expression system and the target gene encoding Glu19-Pro254 is expressed fused with a 6His tag at the C-terminus. Mouse DNAX accessory molecule-1 (DNAM-1) is a type I transmembrane glycoprotein that belongs to the immunoglobulin superfamily. As an activating receptor, it interacts with the ligands CD155 and CD112, and activates natural killer (NK) cells via its immu-noreceptor tyrosine-based activatory motif (ITAM) . Mature mouse DNAM-1 has extracellular domain (ECD) that contains two Ig-like C2-set domains, and possesses a cytoplasmic region that contains motifs for binding PDZ domains. DNAM-1 is expressed on several lymphoid and myeloid cell types and interacts with CD155/PVR and Nectin-2/CD112. Ligation of DNAM-1 promotes the activation of NK cells, CD8+ T cells, and mast cells, induces dendritic cell maturation, initiates megakaryocyte and activated platelet adhesion to vascular endothelial cells, and stimulates monocyte extravasation; Conversely, it inhibits the formation of osteoclasts. Platelet-endothelium interactions that are mediated by DNAM-1 enable the metastasis of tumor cells to the lung.

Product Specifications

Gene Name

Cd226

Gene ID

225825

UniProt

Q8K4F0

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

EETLWDTTVRLSETMTLECVYPLTHNLTQVEWTKNTGTKTVSIAVYNPNHNMHIESNYLHRVHFLNSTVGFRNMSLSFYNASEADIGIYSCLFHAFPNGPWEKKIKVVWSDSFEIAAPSDSYLSAEPGQDVTLTCQLPRTWPVQQVIWEKVQPHQVDILASCNLSQETRYTSKYLRQTRSNCSQGSMKSILIIPNAMAADSGLYRCRSEAITGKNKSFVIRLIITDGGTNKHFILPHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Oncoprotein-induced transcript 3 protein, Oit3 ELISA KIT
ELI-05607m 96 Tests

Mouse Oncoprotein-induced transcript 3 protein, Oit3 ELISA KIT

Sign In for Pricing
View Details
UNC5CL CRISPRa sgRNA lentivector (set of three targets)(Mouse)
49184124 3x 1.0µg DNA

UNC5CL CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
DSTN Antibody
MBS1492033-01 0.05 mg

DSTN Antibody

Sign In for Pricing
View Details
DSTN Antibody
MBS1492033-02 0.1 mg

DSTN Antibody

Sign In for Pricing
View Details
DSTN Antibody
MBS1492033-03 5x 0.1 mg

DSTN Antibody

Sign In for Pricing
View Details
Mouse Monoclonal FAK Antibody (OTI4D11) [Alexa Fluor 647]
NBP2-71268AF647 0.1 mL

Mouse Monoclonal FAK Antibody (OTI4D11) [Alexa Fluor 647]

Sign In for Pricing
View Details