Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Platelet Receptor Gi24/VISTA/B7-H5 (C-6His)

Source: Human Cells. MW :18.6kD. Recombinant Mouse Platelet receptor Gi24 is produced by our Mammalian expression system and the target gene encoding Phe33-Ala191 is expressed fused with a 6His tag at the C-terminus. Mouse Platelet receptor Gi24 (VISTA) is a transmembrane glycoprotein with homology to B7like immune costimulatory molecules. Mature mouse Gi24 contains a 159 amino acid (aa) extracellular domain (ECD) with one V-type Ig-like domain, a 21 aa transmembrane segment, and a 97 aa cytoplasmic domain. VISTA promotes both MT1-MMP expression and the MT1-MMP mediated activation of MMP-2. It supports the differentiation of embryonic stem cells (ESC) and enhances BMP-4 induced signaling in ESC, but it is also down-regulated following BMP-4 exposure. It binds to BMP-4 directly and also associates with the type I BMP receptor Activin RIB/ALK-4. It is expressed on the surface of naà ̄ve CD4+ T cells and regulatory T cells. It is up-regulated in vivo on activated monocytes and dendritic cells. VISTA inhibits CD4+ and CD8+ T cell proliferation and their production of IL-2 and IFN- gamma . Its expression on tumor cells attenuates the antitumor immune response and enables more rapid tumor progression.

Product Specifications

Gene Name

Vsir

Gene ID

74048

UniProt

Q9D659

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

FKVTTPYSLYVCPEGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQMCKEHRPIRNFTLQHLQHHGSHLKANASHDQPQKHGLELASDHHGNFSITLRNVTPRDSGLYCCLVIELKNHHPEQRFYGSMELQVQAGKGSGSTCMASNEQDSDSITAAHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal GHITM Antibody (42) [CoraFluor 1]
NBP3-12773CL1 0.1 mL

Mouse Monoclonal GHITM Antibody (42) [CoraFluor 1]

Ask
View Details
Mouse Human CD45 (PE)
MBS8559341-01 0.1 mL

Mouse Human CD45 (PE)

Ask
View Details
Mouse Human CD45 (PE)
MBS8559341-02 0.1 mL (AF405L)

Mouse Human CD45 (PE)

Ask
View Details
Mouse Human CD45 (PE)
MBS8559341-03 0.1 mL (AF405S)

Mouse Human CD45 (PE)

Ask
View Details
Mouse Human CD45 (PE)
MBS8559341-04 0.1 mL (AF610)

Mouse Human CD45 (PE)

Ask
View Details
Mouse Human CD45 (PE)
MBS8559341-05 0.1 mL (AF635)

Mouse Human CD45 (PE)

Ask
View Details