Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human GDF-5/BMP-14

Source: E. coli. MW :13.7kD. Recombinant Human Growth/Differentiation Factor 5 is produced by our E.coli expression system and the target gene encoding Ala382-Arg501 is expressed. Growth Differentiation Factor 5 (GDF-5, BMP-14) is a member of the BMP family of TGF beta superfamily proteins. Human GDF-5, -6, and -7 are a defined subgroup of the BMP family. GDF-5 is synthesized as a homodimeric precursor protein consisting of a 354 amino acid (aa) Nterminal proregion and a 120 aa C-terminal mature peptide. Mature human GDF-5 shares 99% aa sequence identity with both mature mouse and rat GDF-5. GDF-5 signaling is mediated by formation of a heterodimeric complex consisting of a type 1 (BMPR-IB) and a type II (BMPR-IIor Activin RII) serine/threonine kinase receptor which results in the phosphorylation and activation of cytosolic Smad proteins (Smad1, 5, and 8) . GDF-5 is involved in multiple developmental processes including limb generation, cartilage development, joint formation, bone morphogenesis, cell survival, and neuritogenesis. Inhibition of GDF-5 expression or alteration of its signaling can facilitate the development of osteoarthritis.

Product Specifications

Gene Name

GDF5

Gene ID

8200

UniProt

P43026

Components

Lyophilized from a 0.2 μm filtered solution of 4mM HCl.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MAPLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ZBTB8 (ZBTB8A) (NM_001040441) Human Over-expression Lysate
LS653121-20ug 20 µg

ZBTB8 (ZBTB8A) (NM_001040441) Human Over-expression Lysate

Ask
View Details
Latex Tube English Type, 10.00 x 2.50 mm, (Sales Unit: 25 m)
1216450 25 PCS/PCK

Latex Tube English Type, 10.00 x 2.50 mm, (Sales Unit: 25 m)

Ask
View Details
Histone H3.1 (Ab-10) Antibody
MBS9402093-01 0.05 mL

Histone H3.1 (Ab-10) Antibody

Ask
View Details
Histone H3.1 (Ab-10) Antibody
MBS9402093-02 0.1 mL

Histone H3.1 (Ab-10) Antibody

Ask
View Details
Histone H3.1 (Ab-10) Antibody
MBS9402093-03 5x 0.1 mL

Histone H3.1 (Ab-10) Antibody

Ask
View Details
Olfr325 (NM_207153) Mouse Tagged ORF Clone
MR215509 10 µg

Olfr325 (NM_207153) Mouse Tagged ORF Clone

Ask
View Details