Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human GDF-5/BMP-14

Source: E. coli. MW :13.7kD. Recombinant Human Growth/Differentiation Factor 5 is produced by our E.coli expression system and the target gene encoding Ala382-Arg501 is expressed. Growth Differentiation Factor 5 (GDF-5, BMP-14) is a member of the BMP family of TGF beta superfamily proteins. Human GDF-5, -6, and -7 are a defined subgroup of the BMP family. GDF-5 is synthesized as a homodimeric precursor protein consisting of a 354 amino acid (aa) Nterminal proregion and a 120 aa C-terminal mature peptide. Mature human GDF-5 shares 99% aa sequence identity with both mature mouse and rat GDF-5. GDF-5 signaling is mediated by formation of a heterodimeric complex consisting of a type 1 (BMPR-IB) and a type II (BMPR-IIor Activin RII) serine/threonine kinase receptor which results in the phosphorylation and activation of cytosolic Smad proteins (Smad1, 5, and 8) . GDF-5 is involved in multiple developmental processes including limb generation, cartilage development, joint formation, bone morphogenesis, cell survival, and neuritogenesis. Inhibition of GDF-5 expression or alteration of its signaling can facilitate the development of osteoarthritis.

Product Specifications

Gene Name

GDF5

Gene ID

8200

UniProt

P43026

Components

Lyophilized from a 0.2 μm filtered solution of 4mM HCl.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MAPLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

COPG2 (FITC)
559142-01 50 µg

COPG2 (FITC)

Ask
View Details
COPG2 (FITC)
559142-02 100 µg

COPG2 (FITC)

Ask
View Details
KLF14, CT (KLF14, BTEB5, Krueppel-like factor 14, Basic transcription element-binding protein 5, Transcription factor BTEB5) (MaxLight 490)
MBS6313925-01 0.1 mL

KLF14, CT (KLF14, BTEB5, Krueppel-like factor 14, Basic transcription element-binding protein 5, Transcription factor BTEB5) (MaxLight 490)

Ask
View Details
KLF14, CT (KLF14, BTEB5, Krueppel-like factor 14, Basic transcription element-binding protein 5, Transcription factor BTEB5) (MaxLight 490)
MBS6313925-02 5x 0.1 mL

KLF14, CT (KLF14, BTEB5, Krueppel-like factor 14, Basic transcription element-binding protein 5, Transcription factor BTEB5) (MaxLight 490)

Ask
View Details
Recombinant Burkholderia pseudomallei Membrane protein insertase YidC (yidC), partial
MBS7063967 Inquire

Recombinant Burkholderia pseudomallei Membrane protein insertase YidC (yidC), partial

Ask
View Details
MDA-MB-453 FFPE Cell Pellet Block
BreFFPE-CP001 1 Block

MDA-MB-453 FFPE Cell Pellet Block

Ask
View Details