Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human GDF-5/BMP-14

Source: E. coli. MW :13.7kD. Recombinant Human Growth/Differentiation Factor 5 is produced by our E.coli expression system and the target gene encoding Ala382-Arg501 is expressed. Growth Differentiation Factor 5 (GDF-5, BMP-14) is a member of the BMP family of TGF beta superfamily proteins. Human GDF-5, -6, and -7 are a defined subgroup of the BMP family. GDF-5 is synthesized as a homodimeric precursor protein consisting of a 354 amino acid (aa) Nterminal proregion and a 120 aa C-terminal mature peptide. Mature human GDF-5 shares 99% aa sequence identity with both mature mouse and rat GDF-5. GDF-5 signaling is mediated by formation of a heterodimeric complex consisting of a type 1 (BMPR-IB) and a type II (BMPR-IIor Activin RII) serine/threonine kinase receptor which results in the phosphorylation and activation of cytosolic Smad proteins (Smad1, 5, and 8) . GDF-5 is involved in multiple developmental processes including limb generation, cartilage development, joint formation, bone morphogenesis, cell survival, and neuritogenesis. Inhibition of GDF-5 expression or alteration of its signaling can facilitate the development of osteoarthritis.

Product Specifications

Gene Name

GDF5

Gene ID

8200

UniProt

P43026

Components

Lyophilized from a 0.2 μm filtered solution of 4mM HCl.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MAPLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TRBP Recombinant Antibody, AbBy Fluor™ 680 Conjugated
bsm-61820R-BF680-01 20 µL

TRBP Recombinant Antibody, AbBy Fluor™ 680 Conjugated

Ask
View Details
TRBP Recombinant Antibody, AbBy Fluor™ 680 Conjugated
bsm-61820R-BF680-02 100 µL

TRBP Recombinant Antibody, AbBy Fluor™ 680 Conjugated

Ask
View Details
Melittin
TBW01293 unit

Melittin

Ask
View Details
Huntingtin Associated Protein 1 (HAP1) (NM_001079870) Human Untagged Clone
SC315809 10 µg

Huntingtin Associated Protein 1 (HAP1) (NM_001079870) Human Untagged Clone

Ask
View Details
Mouse Monoclonal VSIG3/IGSF11 Antibody (973422) [Janelia Fluor 525]
FAB92293JF525 0.1 mL

Mouse Monoclonal VSIG3/IGSF11 Antibody (973422) [Janelia Fluor 525]

Ask
View Details
Research Grade Anti-Human CD254/RANKL/TNFSF11 (JHL1266)
HT439066-01 100 µg

Research Grade Anti-Human CD254/RANKL/TNFSF11 (JHL1266)

Ask
View Details