Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human S100A16

Source: E. coli. MW :11.8kD. Recombinant Human Protein S100-A16 is produced by our E.coli expression system and the target gene encoding Met1-Ser103 is expressed. S100A16 is a member of S100 protein superfamily that carries calcium-binding EF-handmotifs. S100 proteins are cell-and tissue-specific and are involved in many intra-and extracellular processes hrough interacting with specific target proteins. S100A16 expression was found to be astrocyte-specific. The S100A16 protein was found to accumulate within nucleoli and to translocate to the cytoplasm in response to Ca (2+) stimulation. The homodimeric structure of human S100A16 in the apo state has been obtained both in the solid state and insolution, resulting in good agreement between the structures with the exception of two loop regions. The homodimeric solution structure of human S100A16 was also calculated in the calcium (II) -bound form. Immunoprecipitation analysis revealed that S100A16 could physically interact with tumor suppress or protein p53, also a known inhibitor of adipogenesis. Overexpression or RNA interference-initiated reduction of S100A16 led to the inhibition or activation of the expression of p53-responsivegenes, respectively. S100A16 protein is a novel adipogenesis-promoting factor.

Product Specifications

Gene Name

S100A16

Gene ID

140576

UniProt

Q96FQ6

Components

Lyophilized from a 0.2 μm filtered solution of 20mM Tris, 500mM NaCl, pH8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MSDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQSSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBMY2KP 3'UTR Lenti-reporter-Luc Vector
38691081 1.0 µg

RBMY2KP 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Rabbit IgG Native Protein
117002 1 mg

Rabbit IgG Native Protein

Sign In for Pricing
View Details
genesig Std Real-time PCR detection kit for Lymphocystivirus
Z-Path-LCV-std 150 Tests

genesig Std Real-time PCR detection kit for Lymphocystivirus

Sign In for Pricing
View Details
Anti-CD16/FCGR3 Antibody (PE), Mouse Monoclonal
MBS8102593-01 25 Tests

Anti-CD16/FCGR3 Antibody (PE), Mouse Monoclonal

Sign In for Pricing
View Details
Anti-CD16/FCGR3 Antibody (PE), Mouse Monoclonal
MBS8102593-02 100 Tests

Anti-CD16/FCGR3 Antibody (PE), Mouse Monoclonal

Sign In for Pricing
View Details
Anti-CD16/FCGR3 Antibody (PE), Mouse Monoclonal
MBS8102593-03 5x 100 Tests

Anti-CD16/FCGR3 Antibody (PE), Mouse Monoclonal

Sign In for Pricing
View Details