Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human S100A11

Source: E. coli. MW :11.7kD. Recombinant Human Protein S100-A11 is produced by our E.coli expression system and the target gene encoding Met1-Thr105 is expressed. S100A11 is a member of the S100 family of calcium binding proteins. Human S100A11 contains two EF hand motifs and shares 82% amino acid sequence identity with mouse and rat S100A11. It forms covalent homodimers upon transglutamination and also disulfide-linked tetramers. S100A11 is secreted by keratinocytes and can be crosslinked into the cornified envelope of the skin. Dimerization enhances its ability to signal through RAGE on keratinocytes, induce the production of EGF family proteins, and induce cell proliferation. Dimerization also enables S100A11 to bind RAGE on chondrocytes, leading to chondrocyte hypertrophy and catabolism of the cartilage matrix. S100A11 is additionally found in the cytosol where it becomes phosphorylated and translocates to the nucleus in response to DNA damage, RELM alpha exposure, or elevated extracellular calcium concentrations. Calcium also promotes S100A11 association with S100B as well as Annexins A1, A2, and A6. S100A11-Annexin A2 complexes are recruited to sites of plasma membrane damage where they facilitate membrane repair in migrating cancer cells. S100A11 is upregulated in various cancers and supports tumor cell proliferation, invasion, and migration. In addition, S100A11 is produced in the ovary, and it acts on cumulus cells to inhibit oocyte fertilization.

Product Specifications

Gene Name

S100A11

Gene ID

6282

UniProt

P31949

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mannose Receptor/CD206 Rabbit pAb
A11816 200 µL

Mannose Receptor/CD206 Rabbit pAb

Sign In for Pricing
View Details
Slc39a13 Polyclonal Antibody, HRP Conjugated
A55644-100 100 µL

Slc39a13 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
LOC100042971 siRNA (m)
sc-148188 10 µM

LOC100042971 siRNA (m)

Sign In for Pricing
View Details
PIC 354-FSA-A5-B7527 AC Signs
809354 Card of 1 Pictogram(s)

PIC 354-FSA-A5-B7527 AC Signs

Sign In for Pricing
View Details
Human S100P Ready-To-Use IHC Kit
orb1974480 50 Tests

Human S100P Ready-To-Use IHC Kit

Sign In for Pricing
View Details
MRPL4 (39S Ribosomal Protein L4, Mitochondrial, L4mt, MRP-L4, CDABP0091, CGI-28, MGC16367, MGC2681) (FITC)
129866-FITC 100 µL

MRPL4 (39S Ribosomal Protein L4, Mitochondrial, L4mt, MRP-L4, CDABP0091, CGI-28, MGC16367, MGC2681) (FITC)

Sign In for Pricing
View Details