Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human S100A11

Source: E. coli. MW :11.7kD. Recombinant Human Protein S100-A11 is produced by our E.coli expression system and the target gene encoding Met1-Thr105 is expressed. S100A11 is a member of the S100 family of calcium binding proteins. Human S100A11 contains two EF hand motifs and shares 82% amino acid sequence identity with mouse and rat S100A11. It forms covalent homodimers upon transglutamination and also disulfide-linked tetramers. S100A11 is secreted by keratinocytes and can be crosslinked into the cornified envelope of the skin. Dimerization enhances its ability to signal through RAGE on keratinocytes, induce the production of EGF family proteins, and induce cell proliferation. Dimerization also enables S100A11 to bind RAGE on chondrocytes, leading to chondrocyte hypertrophy and catabolism of the cartilage matrix. S100A11 is additionally found in the cytosol where it becomes phosphorylated and translocates to the nucleus in response to DNA damage, RELM alpha exposure, or elevated extracellular calcium concentrations. Calcium also promotes S100A11 association with S100B as well as Annexins A1, A2, and A6. S100A11-Annexin A2 complexes are recruited to sites of plasma membrane damage where they facilitate membrane repair in migrating cancer cells. S100A11 is upregulated in various cancers and supports tumor cell proliferation, invasion, and migration. In addition, S100A11 is produced in the ovary, and it acts on cumulus cells to inhibit oocyte fertilization.

Product Specifications

Gene Name

S100A11

Gene ID

6282

UniProt

P31949

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAD54L2 ELISA Kit (Human) (OKCD01099)
OKCD01099 96 Well

RAD54L2 ELISA Kit (Human) (OKCD01099)

Sign In for Pricing
View Details
Recombinant Aotus nigriceps Cytochrome c oxidase subunit 2 (MT-CO2), partial
MBS7088417 Inquire

Recombinant Aotus nigriceps Cytochrome c oxidase subunit 2 (MT-CO2), partial

Sign In for Pricing
View Details
Cyanine 5 Tyramide
6458/1 1 mg

Cyanine 5 Tyramide

Sign In for Pricing
View Details
TRIM22 Mouse Monoclonal Antibody [Clone ID: OTI1A10]
TA505295 100 µL

TRIM22 Mouse Monoclonal Antibody [Clone ID: OTI1A10]

Sign In for Pricing
View Details
Human TMEM70 Protein Lysate 20ug
IHUTMEM70PLLY20UG 20 µg

Human TMEM70 Protein Lysate 20ug

Sign In for Pricing
View Details
Tulip sp. Lectin (TL) - Pure
30330052-1 5mg

Tulip sp. Lectin (TL) - Pure

Sign In for Pricing
View Details