Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse S100A11 (N-6His)

Source: E. coli. MW :12.6kD. Recombinant Mouse S100A11 is produced by our E.coli expression system and the target gene encoding Met1-Ile98 is expressed with a 6His at the N-terminus. Protein S100-A11 (S100A11) is a member of the S-100 family. S100A11 is widely expressed in multi pletissues, and is located in cytoplasm, nucleus, and even cell periphery. S100A11 exists as a non-covalent homodimer with an antiparallel conformation. Ca (2+) binding to S100A11 would trigger conformational changes which would expose the hydrophobic cleft of S100A11 and facilitate its interaction with target proteins. As a dual cell growth mediator, S100A11 acts as either a tumor suppressor or promoter in many different types of tumors and would play respective roles in influencing the proliferatin of the cancer cells. In the nucleus, S100A11 suppresses the growth of keratinocytes through p21 (CIP1/WAF1) activation and induces cell differentiation. S100A11 is also a novel diagnostic marker in breast carcinoma.

Product Specifications

Gene Name

S100a11

Gene ID

20195

UniProt

P50543

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MNHKVHHHHHHMMPTETERCIESLIAVFQKYSGKDGNNTQLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDLNCDGQLDFQEFLNLIGGLAIACHDSFIQTSQKRI

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-STAG2 Cohesin Complex Component Rabbit Monoclonal Antibody
2778-01 20 μL

Anti-STAG2 Cohesin Complex Component Rabbit Monoclonal Antibody

Ask
View Details
Anti-STAG2 Cohesin Complex Component Rabbit Monoclonal Antibody
2778-02 100 μL

Anti-STAG2 Cohesin Complex Component Rabbit Monoclonal Antibody

Ask
View Details
Human PMEL knockdown cell line
ABC-KD11806 1 Vial

Human PMEL knockdown cell line

Ask
View Details
Mouse MEA1 siRNA
abx923815-01 15 nmol

Mouse MEA1 siRNA

Ask
View Details
Mouse MEA1 siRNA
abx923815-02 30 nmol

Mouse MEA1 siRNA

Ask
View Details
Human ICA (Islet cell antibody) ELISA Kit
ELK0907-01 48 Tests

Human ICA (Islet cell antibody) ELISA Kit

Ask
View Details