Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant S. cerevisiae TIM14

Source: E.coli. MW :7.9kD. Recombinant S. cerevisiae Mitochondrial Import Inner Membrane Translocase Subunit TIM14 is produced by our E.coli expression system and the target gene encoding Phe99-Lys168 is expressed. Mitochondrial import inner membrane translocase subunit TIM14 (TIM14) is an essential component of the PAM complex. PAM complex is required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. In the complex, TIM14 is required to stimulate activity of mtHSP70 (SSC1) . TIM14 belongs to the DnaJ family, which has been involved in Hsp40/Hsp70 chaperone systems. As a mitochondrial chaperone, TIM14 functions as part of the TIM23 complex import motor to facilitate the import of nuclear-encoded proteins into the mitochondria. TIM14 also complexes with prohibitin complexes to regulate mitochondrial morphogenesis, and has been implicated in dilated cardiomyopathy with ataxia.

Product Specifications

Gene Name

PAM18

Gene ID

850694

UniProt

Q07914

Components

Lyophilized from a 0.2 μm filtered solution of 20mM Tris,300mM NaCl, pH8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

FLKGGFDPKMNSKEALQILNLTENTLTKKKLKEVHRKIMLANHPDKGGSPFLATKINEAKDFLEKRGISK

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

AA-PEG-AA, 400
HO121121-400 Inquire

AA-PEG-AA, 400

Ask
View Details
Human urease related protein C,UreC ELISA Kit
CN-04181H2 48T

Human urease related protein C,UreC ELISA Kit

Ask
View Details
NFAT1 (NFATC2) (NM_001258292) Human Untagged Clone
SC332639 10 µg

NFAT1 (NFATC2) (NM_001258292) Human Untagged Clone

Ask
View Details
Recombinant Tolumonas auensis Aspartate carbamoyltransferase (pyrB)
MBS1166326-01 0.02 mg (E-Coli)

Recombinant Tolumonas auensis Aspartate carbamoyltransferase (pyrB)

Ask
View Details
Recombinant Tolumonas auensis Aspartate carbamoyltransferase (pyrB)
MBS1166326-02 0.02 mg (Yeast)

Recombinant Tolumonas auensis Aspartate carbamoyltransferase (pyrB)

Ask
View Details
Recombinant Tolumonas auensis Aspartate carbamoyltransferase (pyrB)
MBS1166326-03 0.1 mg (E-Coli)

Recombinant Tolumonas auensis Aspartate carbamoyltransferase (pyrB)

Ask
View Details