Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant S. cerevisiae TIM14

Source: E.coli. MW :7.9kD. Recombinant S. cerevisiae Mitochondrial Import Inner Membrane Translocase Subunit TIM14 is produced by our E.coli expression system and the target gene encoding Phe99-Lys168 is expressed. Mitochondrial import inner membrane translocase subunit TIM14 (TIM14) is an essential component of the PAM complex. PAM complex is required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. In the complex, TIM14 is required to stimulate activity of mtHSP70 (SSC1) . TIM14 belongs to the DnaJ family, which has been involved in Hsp40/Hsp70 chaperone systems. As a mitochondrial chaperone, TIM14 functions as part of the TIM23 complex import motor to facilitate the import of nuclear-encoded proteins into the mitochondria. TIM14 also complexes with prohibitin complexes to regulate mitochondrial morphogenesis, and has been implicated in dilated cardiomyopathy with ataxia.

Product Specifications

Gene Name

PAM18

Gene ID

850694

UniProt

Q07914

Components

Lyophilized from a 0.2 μm filtered solution of 20mM Tris,300mM NaCl, pH8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

FLKGGFDPKMNSKEALQILNLTENTLTKKKLKEVHRKIMLANHPDKGGSPFLATKINEAKDFLEKRGISK

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

3''-O-Galloylmyricitrin
MF-0056632 5 mg

3''-O-Galloylmyricitrin

Ask
View Details
Erlenmeyer Culture Flask, Seal Cap, 1L
23406 12 PCS/Carton

Erlenmeyer Culture Flask, Seal Cap, 1L

Ask
View Details
Lentiviral human FRG2B shRNA (UAS) - Lentiviral human FRG2B shRNA (UAS, iRFP) (25)
GTR15085622 1 Vial

Lentiviral human FRG2B shRNA (UAS) - Lentiviral human FRG2B shRNA (UAS, iRFP) (25)

Ask
View Details
MMP7 (Matrilysin, Matrin, Matrix Metalloproteinase-7, MMP-7, Pump-1 Protease, Uterine Metalloproteinase, MPSL1, PUMP1) (PE)
MBS6385697-01 0.1 mL

MMP7 (Matrilysin, Matrin, Matrix Metalloproteinase-7, MMP-7, Pump-1 Protease, Uterine Metalloproteinase, MPSL1, PUMP1) (PE)

Ask
View Details
MMP7 (Matrilysin, Matrin, Matrix Metalloproteinase-7, MMP-7, Pump-1 Protease, Uterine Metalloproteinase, MPSL1, PUMP1) (PE)
MBS6385697-02 5x 0.1 mL

MMP7 (Matrilysin, Matrin, Matrix Metalloproteinase-7, MMP-7, Pump-1 Protease, Uterine Metalloproteinase, MPSL1, PUMP1) (PE)

Ask
View Details
PTPRK CRISPRa sgRNA lentivector (set of three targets)(Human)
38178121 3x 1.0µg DNA

PTPRK CRISPRa sgRNA lentivector (set of three targets)(Human)

Ask
View Details