Recombinant S. cerevisiae TIM14
Source: E.coli. MW :7.9kD. Recombinant S. cerevisiae Mitochondrial Import Inner Membrane Translocase Subunit TIM14 is produced by our E.coli expression system and the target gene encoding Phe99-Lys168 is expressed. Mitochondrial import inner membrane translocase subunit TIM14 (TIM14) is an essential component of the PAM complex. PAM complex is required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. In the complex, TIM14 is required to stimulate activity of mtHSP70 (SSC1) . TIM14 belongs to the DnaJ family, which has been involved in Hsp40/Hsp70 chaperone systems. As a mitochondrial chaperone, TIM14 functions as part of the TIM23 complex import motor to facilitate the import of nuclear-encoded proteins into the mitochondria. TIM14 also complexes with prohibitin complexes to regulate mitochondrial morphogenesis, and has been implicated in dilated cardiomyopathy with ataxia.
Product Specifications
Gene Name
PAM18
Gene ID
850694
UniProt
Q07914
Components
Lyophilized from a 0.2 μm filtered solution of 20mM Tris,300mM NaCl, pH8.0.
Shipping Conditions
The product is shipped on dry ice/ice packs.
Storage Conditions
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
FLKGGFDPKMNSKEALQILNLTENTLTKKKLKEVHRKIMLANHPDKGGSPFLATKINEAKDFLEKRGISK
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items