Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nucleobindin-2/Nesfatin-1

Source: E.coli. MW :9.6kD. Recombinant Human Nucleobindin-2 is produced by our E.coli expression system and the target gene encoding Val25-Leu106 is expressed. Nesfatin-1 is a metabolic polypeptide encoded in the N-terminal region of the precursor protein, Nucleobindin2 (NUCB2) . Nesfatin-1 is a neuropeptide produced in the hypothalamus of mammals. It participates in the regulation of hunger and fat storage. Nesfatin-1 is also expressed in other areas of the brain, and in pancreatic islets beta-cells, gastric endocrine cells and adipocytes. Nesfatin-1 suppresses food intake and can regulate energy metabolism in a Leptin independent manner. Nesfatin-1 may also exert hypertensive roles and modulate blood pressure through directly acting on peripheral arterial resistance.

Product Specifications

Gene Name

NUCB2

Gene ID

4925

UniProt

P80303

Components

Lyophilized from a 0.2 μm filtered solution of 10mM Sodium Phosphate, pH6.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

VPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKHFREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDEL

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

KIR3DL3 protein, Human, Recombinant (His)
E51P91463 20 µg

KIR3DL3 protein, Human, Recombinant (His)

Ask
View Details
MLN 4924 2-Sulfonamide
MBS6037524-01 1 mg

MLN 4924 2-Sulfonamide

Ask
View Details
MLN 4924 2-Sulfonamide
MBS6037524-02 5x 1 mg

MLN 4924 2-Sulfonamide

Ask
View Details
PRPF3 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
37757156 3x 1.0 µg DNA

PRPF3 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Ask
View Details
C.I. Azoic Coupling Component 5
MF-0044321-01 25 mg

C.I. Azoic Coupling Component 5

Ask
View Details
C.I. Azoic Coupling Component 5
MF-0044321-02 50 mg

C.I. Azoic Coupling Component 5

Ask
View Details