Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Retinol-Binding Protein 5

Source: E.coli. MW :15.9kD. Recombinant Human Retinol-binding Protein 5 is produced by our E.coli expression system and the target gene encoding Met1-Arg135 is expressed. Retinol-binding proteins (RBP) are a family of proteins with diverse functions. They are carrier proteins that bind retinol. Retinol and retinoic acid play crucial roles in the modulation of gene expression and overall development of an embryo. However, deficit or excess of either one of these substances can cause early embryo mortality or developmental malformations. Regulation of transport and metabolism of retinol necessary for a successful pregnancy is accomplished via RBP. Retinol binding proteins have been identified within the uterus, embryo, and extraembryonic tissue of the bovine, ovine, and porcine, clearly indicating that RBP plays a role in proper retinol exposure to the embryo and successful transport at the maternal-fetal interface.

Product Specifications

Gene Name

RBP5

Gene ID

83758

UniProt

P82980

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MPPNLTGYYRFVSQKNMEDYLQALNISLAVRKIALLLKPDKEIEHQGNHMTVRTLSTFRNYTVQFDVGVEFEEDLRSVDGRKCQTIVTWEEEHLVCVQKGEVPNRGWRHWLEGEMLYLELTARDAVCEQVFRKVR

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal ZNF276 Antibody [DyLight 650]
NBP1-03342C 0.1 mL

Rabbit Polyclonal ZNF276 Antibody [DyLight 650]

Ask
View Details
Lentiviral human ZNF222 sgRNA gene knockout kit - Lentiviral human ZNF222 sgRNA gene knockout kit (100)
GTR15399997 1 Vial

Lentiviral human ZNF222 sgRNA gene knockout kit - Lentiviral human ZNF222 sgRNA gene knockout kit (100)

Ask
View Details
Gamma-Aminobutyric Acid Receptor Subunit Beta-2 (gABRB2) Antibody
abx301934-01 20 µg

Gamma-Aminobutyric Acid Receptor Subunit Beta-2 (gABRB2) Antibody

Ask
View Details
Gamma-Aminobutyric Acid Receptor Subunit Beta-2 (gABRB2) Antibody
abx301934-02 50 µg

Gamma-Aminobutyric Acid Receptor Subunit Beta-2 (gABRB2) Antibody

Ask
View Details
Gamma-Aminobutyric Acid Receptor Subunit Beta-2 (gABRB2) Antibody
abx301934-03 100 µg

Gamma-Aminobutyric Acid Receptor Subunit Beta-2 (gABRB2) Antibody

Ask
View Details
Gamma-Aminobutyric Acid Receptor Subunit Beta-2 (gABRB2) Antibody
abx301934-04 200 µg

Gamma-Aminobutyric Acid Receptor Subunit Beta-2 (gABRB2) Antibody

Ask
View Details