Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Retinol-Binding Protein 5

Source: E.coli. MW :15.9kD. Recombinant Human Retinol-binding Protein 5 is produced by our E.coli expression system and the target gene encoding Met1-Arg135 is expressed. Retinol-binding proteins (RBP) are a family of proteins with diverse functions. They are carrier proteins that bind retinol. Retinol and retinoic acid play crucial roles in the modulation of gene expression and overall development of an embryo. However, deficit or excess of either one of these substances can cause early embryo mortality or developmental malformations. Regulation of transport and metabolism of retinol necessary for a successful pregnancy is accomplished via RBP. Retinol binding proteins have been identified within the uterus, embryo, and extraembryonic tissue of the bovine, ovine, and porcine, clearly indicating that RBP plays a role in proper retinol exposure to the embryo and successful transport at the maternal-fetal interface.

Product Specifications

Gene Name

RBP5

Gene ID

83758

UniProt

P82980

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MPPNLTGYYRFVSQKNMEDYLQALNISLAVRKIALLLKPDKEIEHQGNHMTVRTLSTFRNYTVQFDVGVEFEEDLRSVDGRKCQTIVTWEEEHLVCVQKGEVPNRGWRHWLEGEMLYLELTARDAVCEQVFRKVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat AP-4 complex subunit epsilon-1 (AP4E1) ELISA Kit
MBS7241237-01 48 Well

Goat AP-4 complex subunit epsilon-1 (AP4E1) ELISA Kit

Sign In for Pricing
View Details
Goat AP-4 complex subunit epsilon-1 (AP4E1) ELISA Kit
MBS7241237-02 96 Well

Goat AP-4 complex subunit epsilon-1 (AP4E1) ELISA Kit

Sign In for Pricing
View Details
Goat AP-4 complex subunit epsilon-1 (AP4E1) ELISA Kit
MBS7241237-03 5x 96 Well

Goat AP-4 complex subunit epsilon-1 (AP4E1) ELISA Kit

Sign In for Pricing
View Details
Goat AP-4 complex subunit epsilon-1 (AP4E1) ELISA Kit
MBS7241237-04 10x 96 Well

Goat AP-4 complex subunit epsilon-1 (AP4E1) ELISA Kit

Sign In for Pricing
View Details
ADAMTS16 (NM_139056) Human Over-expression Lysate
LS170690 100 µg

ADAMTS16 (NM_139056) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Murine IL-6
P5925-1mg 1 mg

Recombinant Murine IL-6

Sign In for Pricing
View Details