Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Retinol-Binding Protein 3 (N-6His)

Source: E.coli. MW :35.2kD. Recombinant Human Retinol-binding Protein 3 is produced by our E.coli expression system and the target gene encoding Thr321-Leu630 is expressed fused with a 6His tag at the N-terminus. Retinol-binding proteins (RBP) are a family of proteins with diverse functions. They are carrier proteins that bind retinol. Retinol and retinoic acid play crucial roles in the modulation of gene expression and overall development of an embryo. However, deficit or excess of either one of these substances can cause early embryo mortality or developmental malformations. Regulation of transport and metabolism of retinol necessary for a successful pregnancy is accomplished via RBP. Retinol binding proteins have been identified within the uterus, embryo, and extraembryonic tissue of the bovine, ovine, and porcine, clearly indicating that RBP plays a role in proper retinol exposure to the embryo and successful transport at the maternal-fetal interface.

Product Specifications

Gene Name

RBP3

Gene ID

5949

UniProt

P10745

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MNHKVHHHHHHMTLRSALPGVVHCLQEVLKDYYTLVDRVPTLLQHLASMDFSTVVSEEDLVTKLNAGLQAASEDPRLLVRAIGPTETPSWPAPDAAAEDSPGVAPELPEDEAIRQALVDSVFQVSVLPGNVGYLRFDSFADASVLGVLAPYVLRQVWEPLQDTEHLIMDLRHNPGGPSSAVPLLLSYFQGPEAGPVHLFTTYDRRTNITQEHFSHMELPGPRYSTQRGVYLLTSHRTATAAEEFAFLMQSLGWATLVGEITAGNLLHTRTVPLLDTPEGSLALTVPVLTFIDNHGEAWLGGGVVPDAIVLAEEALDKAQEVL
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

BRCA1 (NM_007294) Human Mutant ORF Clone
RC403090 10 µg

BRCA1 (NM_007294) Human Mutant ORF Clone

Ask
View Details
Rabbit Anti-Duck IgG (H&L) - Cy5.5
BS22191-01 100 µL

Rabbit Anti-Duck IgG (H&L) - Cy5.5

Ask
View Details
Rabbit Anti-Duck IgG (H&L) - Cy5.5
BS22191-02 500 µL

Rabbit Anti-Duck IgG (H&L) - Cy5.5

Ask
View Details
Gm12463 Mouse siRNA Oligo Duplex (Locus ID 545618)
SR415923 1 Kit

Gm12463 Mouse siRNA Oligo Duplex (Locus ID 545618)

Ask
View Details
ZCCHC18 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
50762064 1.0 µg DNA

ZCCHC18 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Ask
View Details
GENLISA™ Human Protein Phosphatase 1, Regulatory Subunit 1B (PPP1R1B) ELISA
KBH22105 1x 96 Well

GENLISA™ Human Protein Phosphatase 1, Regulatory Subunit 1B (PPP1R1B) ELISA

Ask
View Details