Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cystatin C/CST3 (E.coli)

Source: E.coli. MW :13.4kD. Recombinant Human Cystatin C is produced by our E.coli expression system and the target gene encoding Gly26-Ala146 is expressed. Cystatin C is a member of family 2 of the cystatin superfamily. It is ubiquitous in human tissues and body fluids and mainly used as a biomarker of kidney function. Cystatin C inhibits many cysteine proteases such as papain and Cathepsins B, H, K, L and S. As an inhibitor of cysteine proteinases, Cystatin C is thought to serve an important physiological role as a local regulator of this enzyme activity. Recently, it has been studied for its role in predicting new-onset or deteriorating cardiovascular disease. It also seems to play a role in brain disorders involving amyloid (a specific type of protein deposition), such as Alzheimer's disease.

Product Specifications

Gene Name

CST3

Gene ID

1471

UniProt

P01034

Components

Lyophilized from a 0.2 μm filtered solution of 20mM HEPES,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

IGFALS (Insulin Like Growth Factor Binding Protein (Acid Labile Subunit) Chicken ELISA Kit
E1830 96 Tests

IGFALS (Insulin Like Growth Factor Binding Protein (Acid Labile Subunit) Chicken ELISA Kit

Ask
View Details
Mouse Lymphocytic Choriomeningitis Virus Antibody (LCMV-Ab) ELISA Kit
EIA07203m 1 Kit

Mouse Lymphocytic Choriomeningitis Virus Antibody (LCMV-Ab) ELISA Kit

Ask
View Details
Epiandrosterone Antibody
abx342192-01 1 mg

Epiandrosterone Antibody

Ask
View Details
Epiandrosterone Antibody
abx342192-02 10 mg

Epiandrosterone Antibody

Ask
View Details
N42L1 (N4BP2L1) (NM_001286460) Human Tagged ORF Clone
RG236341 10 µg

N42L1 (N4BP2L1) (NM_001286460) Human Tagged ORF Clone

Ask
View Details
LARP4 Human shRNA Lentiviral Particle (Locus ID 113251)
TL303579V 500 µL Each

LARP4 Human shRNA Lentiviral Particle (Locus ID 113251)

Ask
View Details