Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cystatin C/CST3 (E.coli)

Source: E.coli. MW :13.4kD. Recombinant Human Cystatin C is produced by our E.coli expression system and the target gene encoding Gly26-Ala146 is expressed. Cystatin C is a member of family 2 of the cystatin superfamily. It is ubiquitous in human tissues and body fluids and mainly used as a biomarker of kidney function. Cystatin C inhibits many cysteine proteases such as papain and Cathepsins B, H, K, L and S. As an inhibitor of cysteine proteinases, Cystatin C is thought to serve an important physiological role as a local regulator of this enzyme activity. Recently, it has been studied for its role in predicting new-onset or deteriorating cardiovascular disease. It also seems to play a role in brain disorders involving amyloid (a specific type of protein deposition), such as Alzheimer's disease.

Product Specifications

Gene Name

CST3

Gene ID

1471

UniProt

P01034

Components

Lyophilized from a 0.2 μm filtered solution of 20mM HEPES,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-TAU
MBS448180-01 0.3 mg

Anti-TAU

Ask
View Details
Anti-TAU
MBS448180-02 5x 0.3 mg

Anti-TAU

Ask
View Details
PSG9, ID (PSG9, PSG11, Pregnancy-specific beta-1-glycoprotein 9, PS34, Pregnancy-specific beta-1 glycoprotein B, Pregnancy-specific beta-1-glycoprotein 11, Pregnancy-specific glycoprotein 7) (AP) discontinued
040548-AP 200 µL

PSG9, ID (PSG9, PSG11, Pregnancy-specific beta-1-glycoprotein 9, PS34, Pregnancy-specific beta-1 glycoprotein B, Pregnancy-specific beta-1-glycoprotein 11, Pregnancy-specific glycoprotein 7) (AP) discontinued

Ask
View Details
ADRB2 Antibody
MBS9414764-01 0.1 mL

ADRB2 Antibody

Ask
View Details
ADRB2 Antibody
MBS9414764-02 5x 0.1 mL

ADRB2 Antibody

Ask
View Details
Human SLC27A4 Pre-designed siRNA Set A
SI015007A 1 Each

Human SLC27A4 Pre-designed siRNA Set A

Ask
View Details