Recombinant Human Cystatin C/CST3 (E.coli)
Source: E.coli. MW :13.4kD. Recombinant Human Cystatin C is produced by our E.coli expression system and the target gene encoding Gly26-Ala146 is expressed. Cystatin C is a member of family 2 of the cystatin superfamily. It is ubiquitous in human tissues and body fluids and mainly used as a biomarker of kidney function. Cystatin C inhibits many cysteine proteases such as papain and Cathepsins B, H, K, L and S. As an inhibitor of cysteine proteinases, Cystatin C is thought to serve an important physiological role as a local regulator of this enzyme activity. Recently, it has been studied for its role in predicting new-onset or deteriorating cardiovascular disease. It also seems to play a role in brain disorders involving amyloid (a specific type of protein deposition), such as Alzheimer's disease.
Product Specifications
Gene Name
CST3
Gene ID
1471
UniProt
P01034
Components
Lyophilized from a 0.2 μm filtered solution of 20mM HEPES,150mM NaCl, pH7.4.
Shipping Conditions
The product is shipped on dry ice/ice packs.
Storage Conditions
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
GSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items