Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Peptidyl-prolyl Cis-trans Isomerase A/Cyclophilin A/CYPA

Source: E.coli. MW :18kD. Recombinant Human Peptidyl-prolyl Cis-trans Isomerase A is produced by our E.coli expression system and the target gene encoding Met1-Glu165 is expressed. Peptidyl-prolyl cis-trans isomerase A is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family, which catalyzes the cis-trans isomerization of proline imidic peptide bonds. Cyclophilin A regulate many biological processes, including intracellular signaling, transcription, inflammation, and apoptosis. Cyclophilin is also incorporated into many viruses, including HIV1, where it has been speculated to be involved in functions such as viral assembly and infectivity. The immunosuppressive activity of cyclosporins has been correlated with their ability to form complexes with cyclophilins that inhibit calcineurin phosphatase activity and prevent incorporation of cyclophilin into viral particles. The cyclosporin/cyclophilin complex selectively binds and inactivates calcineurin, making it a useful inhibitor for studying calcineurin activity.

Product Specifications

Gene Name

PPIA

Gene ID

5478

UniProt

P62937

Components

Supplied as a 0.2 μm filtered solution of PBS, 10%glycerol, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Acidovorax citrulli UPF0234 protein Aave_1854 (Aave_1854)
MBS1100299-01 0.02 mg (E-Coli)

Recombinant Acidovorax citrulli UPF0234 protein Aave_1854 (Aave_1854)

Sign In for Pricing
View Details
Recombinant Acidovorax citrulli UPF0234 protein Aave_1854 (Aave_1854)
MBS1100299-02 0.1 mg (E-Coli)

Recombinant Acidovorax citrulli UPF0234 protein Aave_1854 (Aave_1854)

Sign In for Pricing
View Details
Recombinant Acidovorax citrulli UPF0234 protein Aave_1854 (Aave_1854)
MBS1100299-03 0.02 mg (Yeast)

Recombinant Acidovorax citrulli UPF0234 protein Aave_1854 (Aave_1854)

Sign In for Pricing
View Details
Recombinant Acidovorax citrulli UPF0234 protein Aave_1854 (Aave_1854)
MBS1100299-04 0.1 mg (Yeast)

Recombinant Acidovorax citrulli UPF0234 protein Aave_1854 (Aave_1854)

Sign In for Pricing
View Details
Recombinant Acidovorax citrulli UPF0234 protein Aave_1854 (Aave_1854)
MBS1100299-05 0.02 mg (Baculovirus)

Recombinant Acidovorax citrulli UPF0234 protein Aave_1854 (Aave_1854)

Sign In for Pricing
View Details
Recombinant Acidovorax citrulli UPF0234 protein Aave_1854 (Aave_1854)
MBS1100299-06 0.02 mg (Mammalian-Cell)

Recombinant Acidovorax citrulli UPF0234 protein Aave_1854 (Aave_1854)

Sign In for Pricing
View Details