Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse C-C Motif Chemokine 3/CCL3/MIP-1a (N-6His)

Source: E.coli. MW :10.8kD. Recombinant Mouse Fibroblast growth factor 9 is produced by our E.coli expression system and the target gene encoding Met1­Ser208 is expressed with a 7his tag at the C-terminus. C-C Motif Chemokine 3 (MIP-1 alpha, CCL3) is a member of the beta or CC subfamily of chemokines and is closely related to CCL4/MIP-1 beta. CCL3 expression can be induced in a variety of hematopoietic cells, fibroblasts, smooth muscle cells, and epithelial cells. Mature mouse CCL3 shares 73%, 91%, and 82% amino acid sequence identity with human, rat, and cotton rat CCL3, respectively. CCL3 exerts its biological functions through interactions with CCR1, CCR3, and CCR5. It is cleared from the extracellular space by internalization via the decoy chemokine receptor D6. CCL3 promotes the chemoattraction, adhesion to activated vascular endothelium, and cellular activation of many hematopoietic cell types including activated T cells, NK cells, neutrophils, monocytes, immature dendritic cells, and eosinophils. CCL3 is also known as stem cell inhibitor (SCI) and can inhibit the proliferation of hematopoietic progenitor cells. CCL3 bioactivity contributes to tumor metastasis and the inflammatory components of viral infection, rheumatoid arthritis, and hepatitis, although it also can suppress the replication of HIV.

Product Specifications

Gene Name

Ccl3

Gene ID

20302

UniProt

P10855

Components

Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl,5%Trehalose,1mM EDTA, pH8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMDDDDKAPYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Heat Shock 70 KDa Protein 1-Like (HSPA1L) CLIA Kit
abx496513-01 96 Tests

Rat Heat Shock 70 KDa Protein 1-Like (HSPA1L) CLIA Kit

Sign In for Pricing
View Details
Rat Heat Shock 70 KDa Protein 1-Like (HSPA1L) CLIA Kit
abx496513-02 5x 96 Tests

Rat Heat Shock 70 KDa Protein 1-Like (HSPA1L) CLIA Kit

Sign In for Pricing
View Details
Rat Heat Shock 70 KDa Protein 1-Like (HSPA1L) CLIA Kit
abx496513-03 10x 96 Tests

Rat Heat Shock 70 KDa Protein 1-Like (HSPA1L) CLIA Kit

Sign In for Pricing
View Details
NR5A2 (Ligand-binding Domain) (NR5A2, B1F, B1F2, B1-binding Factor, CPF, CYP7A promoter-binding Factor, FTZ-F1beta, FTF, Liver Receptor Homolog 1, LRH1, LRH-1, HB1F, HB1F-2, Nuclear Receptor phr-1, FTZ-F1, Liver Receptor Homolog-1, Nuclear Receptor NR5A2, Receptor phr)
171052 50 µg

NR5A2 (Ligand-binding Domain) (NR5A2, B1F, B1F2, B1-binding Factor, CPF, CYP7A promoter-binding Factor, FTZ-F1beta, FTF, Liver Receptor Homolog 1, LRH1, LRH-1, HB1F, HB1F-2, Nuclear Receptor phr-1, FTZ-F1, Liver Receptor Homolog-1, Nuclear Receptor NR5A2, Receptor phr)

Sign In for Pricing
View Details
Rat Tracheal Epithelial Primary Cells
CC4F75 5x 10^5 Cells/Vial

Rat Tracheal Epithelial Primary Cells

Sign In for Pricing
View Details
Eph receptor B2 (EPHB2) (NM_017449) Human Tagged ORF Clone
RC600049 10 µg

Eph receptor B2 (EPHB2) (NM_017449) Human Tagged ORF Clone

Sign In for Pricing
View Details