Recombinant Mouse C-C Motif Chemokine 3/CCL3/MIP-1a (N-6His)
Source: E.coli. MW :10.8kD. Recombinant Mouse Fibroblast growth factor 9 is produced by our E.coli expression system and the target gene encoding Met1Ser208 is expressed with a 7his tag at the C-terminus. C-C Motif Chemokine 3 (MIP-1 alpha, CCL3) is a member of the beta or CC subfamily of chemokines and is closely related to CCL4/MIP-1 beta. CCL3 expression can be induced in a variety of hematopoietic cells, fibroblasts, smooth muscle cells, and epithelial cells. Mature mouse CCL3 shares 73%, 91%, and 82% amino acid sequence identity with human, rat, and cotton rat CCL3, respectively. CCL3 exerts its biological functions through interactions with CCR1, CCR3, and CCR5. It is cleared from the extracellular space by internalization via the decoy chemokine receptor D6. CCL3 promotes the chemoattraction, adhesion to activated vascular endothelium, and cellular activation of many hematopoietic cell types including activated T cells, NK cells, neutrophils, monocytes, immature dendritic cells, and eosinophils. CCL3 is also known as stem cell inhibitor (SCI) and can inhibit the proliferation of hematopoietic progenitor cells. CCL3 bioactivity contributes to tumor metastasis and the inflammatory components of viral infection, rheumatoid arthritis, and hepatitis, although it also can suppress the replication of HIV.
Product Specifications
Gene Name
Ccl3
Gene ID
20302
UniProt
P10855
Components
Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl,5%Trehalose,1mM EDTA, pH8.0.
Shipping Conditions
The product is shipped on dry ice/ice packs.
Storage Conditions
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
MGSSHHHHHHSSGLVPRGSHMDDDDKAPYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA
Explore Other Products
Browse additional items from our catalog