Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Fibroblast Growth Factor 9/FGF-9 (C-6His)

Source: E.coli. MW :24.4kD. Recombinant Mouse Fibroblast growth factor 9 is produced by our E.coli expression system and the target gene encoding Met1­Ser208 is expressed with a 6his tag at the C-terminus. Fibroblast growth factor-9 (FGF-9) is an approximately 26 kDa secreted glycoprotein of the FGF family. Secreted mouse FGF-9 lacks the N-terminal 1-3 aa and shares >98% sequence identity with rat, human, equine, porcine and bovine FGF-9. FGF-9 plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. In the mouse embryo the location and timing of FGF-9 expression affects development of the skeleton, cerebellum, lungs, heart, vasculature, digestive tract, and testes .It may have a role in glial cell growth and differentiation during development, gliosis during repair and regeneration of brain tissue after damage, differentiation and survival of neuronal cells, and growth stimulation of glial tumors. Deletion of mouse FGF-9 is lethal at birth due to lung hypoplasia, and causes rhizomelia, or shortening of the proximal skeleton. An unusual constitutive dimerization of FGF 9 buries receptor interaction sites which lowers its activity, and increases heparin affinity which inhibits diffusion. A spontaneous mouse mutant, Eks, interferes with dimerization, resulting monomeric, diffusible FGF-9 that causes elbow and knee synostoses (joint fusions) due to FGF-9 misexpression in developing joints.

Product Specifications

Gene Name

Fgf9

Gene ID

14180

UniProt

P54130

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris,150mM NaCl,5%Trehalose,1mM EDTA,20%glycerol,1mM DTT, pH8.5 .

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MHHHHHHMAPLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS*
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CD150 (Y307) (Signaling Lymphocytic Activation Molecule, IPO-3, CDw150, SLAMF1, SLAM) (AP)
MBS6468247-01 0.2 mL

CD150 (Y307) (Signaling Lymphocytic Activation Molecule, IPO-3, CDw150, SLAMF1, SLAM) (AP)

Ask
View Details
CD150 (Y307) (Signaling Lymphocytic Activation Molecule, IPO-3, CDw150, SLAMF1, SLAM) (AP)
MBS6468247-02 5x 0.2 mL

CD150 (Y307) (Signaling Lymphocytic Activation Molecule, IPO-3, CDw150, SLAMF1, SLAM) (AP)

Ask
View Details
Pf4 Mouse qPCR Primer Pair (NM_019932)
MP211048 200 Reactions

Pf4 Mouse qPCR Primer Pair (NM_019932)

Ask
View Details
Cavy Protocadherin Fat 3 (FAT3) ELISA Kit
MBS9397460 Inquire

Cavy Protocadherin Fat 3 (FAT3) ELISA Kit

Ask
View Details
Rabbit anti-RNF20 IHC Antibody, Affinity Purified
MBS3907457-01 0.0025 mg

Rabbit anti-RNF20 IHC Antibody, Affinity Purified

Ask
View Details
Rabbit anti-RNF20 IHC Antibody, Affinity Purified
MBS3907457-02 8 mL

Rabbit anti-RNF20 IHC Antibody, Affinity Purified

Ask
View Details