Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast Growth Factor 4/FGF-4

Source: E.coli. MW :16.9kD. Recombinant Human Fibroblast Growth Factor 4 is produced by our E.coli expression system and the target gene encoding Ser54-Leu206 is expressed. Fibroblast growth factor 4 (FGF-4) is a heparin binding member of the FGF family. The human FGF4 cDNA encodes 206 amino acids (aa) with a 33 aa signal sequence and a 173 aa mature protein with an FGF homology domain that contains a heparin binding region near the C-terminus. Mature human FGF4 shares 91%, 82%, 94% and 91% aa identity with mouse, rat, canine and bovine FGF4, respectively. Human FGF-4 has been shown to exhibit cross species activity. Expression of FGF-4 and its receptors, FGF R1c, 2c, 3c and 4, is spatially and temporally regulated during embryonic development. FGF-4 is proposed to play a physiologically relevant role in human embryonic stem cell selfrenewal. It promotes stem cell proliferation, but may also aid differentiation depending on context and concentration, and is often included in embryonic stem cell media in vitro. FGF-4 is mitogenic for fibroblasts and endothelial cells in vitro and has autocrine transforming potential. It is a potent angiogenesis promoter in vivo and has been investigated as therapy for coronary artery disease.

Product Specifications

Gene Name

FGF4

Gene ID

2249

UniProt

P08620

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MSLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Il11ra1 Mouse shRNA Plasmid (Locus ID 16157)
TL509724 1 Kit

Il11ra1 Mouse shRNA Plasmid (Locus ID 16157)

Ask
View Details
Ceacam1 (NM_001033862) Rat Tagged ORF Clone Lentiviral Particle
RR200281L3V 200 µL

Ceacam1 (NM_001033862) Rat Tagged ORF Clone Lentiviral Particle

Ask
View Details
Anti-Cullin 4A Antibody
MBS8247339-01 0.03 mL

Anti-Cullin 4A Antibody

Ask
View Details
Anti-Cullin 4A Antibody
MBS8247339-02 0.05 mL

Anti-Cullin 4A Antibody

Ask
View Details
Anti-Cullin 4A Antibody
MBS8247339-03 0.1 mL

Anti-Cullin 4A Antibody

Ask
View Details
Anti-Cullin 4A Antibody
MBS8247339-04 0.2 mL

Anti-Cullin 4A Antibody

Ask
View Details