Recombinant Human Osteocrin (N-6His)
Source: E.coli. MW :14kD. Recombinant Human Osteocrin is produced by our expression system and the target gene encoding Val28-Gly133 is expressed with a 6His tag at the N-terminus. Osteocrin is a secreted protein which is primarily expressed in bone and muscle. It is synthesized as a proprotein that undergoes proteolytic processing to generate a mature 50 amino acid C-terminal active peptide.Human Osteocrin proprotein shares 77% and 78% amino acid sequence identity with the rat and mouse protein, respectively. It appears to modulate osteoblastic differentiation. It could also function as an autocrine and paracrine factor linked to glucose metabolism in skeletal muscle.
Product Specifications
Gene Name
OSTN
Gene ID
344901
UniProt
P61366
Components
Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl, pH8.0.
Shipping Conditions
The product is shipped on dry ice/ice packs.
Storage Conditions
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
MGSSHHHHHHSSGLVPRGSHMVDVTTTEAFDSGVIDVQSTPTVREEKSATDLTAKLLLLDELVSLENDVIETKKKRSFSGFGSPLDRLSAGSVDHKGKQRKVVDHPKRRFGIPMDRIGRNRLSNSRG
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog