Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Osteocrin (N-6His)

Source: E.coli. MW :14kD. Recombinant Human Osteocrin is produced by our expression system and the target gene encoding Val28-Gly133 is expressed with a 6His tag at the N-terminus. Osteocrin is a secreted protein which is primarily expressed in bone and muscle. It is synthesized as a proprotein that undergoes proteolytic processing to generate a mature 50 amino acid C-terminal active peptide.Human Osteocrin proprotein shares 77% and 78% amino acid sequence identity with the rat and mouse protein, respectively. It appears to modulate osteoblastic differentiation. It could also function as an autocrine and paracrine factor linked to glucose metabolism in skeletal muscle.

Product Specifications

Gene Name

OSTN

Gene ID

344901

UniProt

P61366

Components

Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl, pH8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMVDVTTTEAFDSGVIDVQSTPTVREEKSATDLTAKLLLLDELVSLENDVIETKKKRSFSGFGSPLDRLSAGSVDHKGKQRKVVDHPKRRFGIPMDRIGRNRLSNSRG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Mouse ADCY9 (KIAA0520), Rabbit Polyclonal
MKA0520PA Inquire

Anti-Mouse ADCY9 (KIAA0520), Rabbit Polyclonal

Sign In for Pricing
View Details
Mmu-miR-3103-3p miRNA Agomir
orb1918170-01 5 nmol

Mmu-miR-3103-3p miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-3103-3p miRNA Agomir
orb1918170-02 10 nmol

Mmu-miR-3103-3p miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-3103-3p miRNA Agomir
orb1918170-03 20 nmol

Mmu-miR-3103-3p miRNA Agomir

Sign In for Pricing
View Details
Mouse Monoclonal Cytokeratin 8 Antibody (K8/383) [DyLight 755]
NBP2-34656IR 0.1 mL

Mouse Monoclonal Cytokeratin 8 Antibody (K8/383) [DyLight 755]

Sign In for Pricing
View Details
Recombinant Human RGS14 Protein
E30P7539 20 µg

Recombinant Human RGS14 Protein

Sign In for Pricing
View Details