Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibrillin-1/Asprosin (N-8His)

Source: Human Cells. MW :17kD. Recombinant Human Asprosin is produced by our Mammalian expression system and the target gene encoding Ser2732-His2871 is expressed with a 8His tag at the N-terminus. Asprosin is a protein hormone that is produced by white adipose tissue in mammals (and potentially by other tissues), which is then transported to the liver and stimulates it to release glucose into the blood stream. In the liver asprosin activates rapid glucose release by a cAMP-dependent pathway. The glucose release by the liver into the blood stream is vital for brain function and survival during fasting. People with neonatal progeroid syndrome lack asprosin, while people with insulin resistance have it in abundance. In animal tests asprosin showed potential for treating type 2 diabetes. When antibodies targeting asprosin were injected into diabetic mice, blood glucose and insulin levels improved.

Product Specifications

Gene Name

FBN1

Gene ID

2200

UniProt

P35555

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

HHHHHHHHSTNETDASNIEDQSETEANVSLASWDVEKTAIFAFNISHVSNKVRILELLPALTTLTNHNRYLIESGNEDGFFKINQKEGISYLHFTKKKPVAGTYSLQISSTPLYKKKELNQLEDKYDKDYLSGELGDNLKMKIQVLLH

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKIP Polyclonal Antibody, Cy7 Conjugated
bs-4287R-Cy7 100 µL

AKIP Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
Phospholipase c eta 1 (PLCH1) (NM_001130960) Human Tagged ORF Clone
RG226422 10 µg

Phospholipase c eta 1 (PLCH1) (NM_001130960) Human Tagged ORF Clone

Sign In for Pricing
View Details
VWC2L Protein Vector (Rat) (pPM-C-His)
PV316193 500 ng

VWC2L Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Canine PTN ELISA Kit
ECP0167 96 Tests

Canine PTN ELISA Kit

Sign In for Pricing
View Details
Recombinant Mouse TGFB1/TGF-beta-1 Protein, N-His
YMB91601 100 μg

Recombinant Mouse TGFB1/TGF-beta-1 Protein, N-His

Sign In for Pricing
View Details
Ggnbp2 sgRNA CRISPR Lentivector (Rat) (Target 1)
K7129802 1.0 µg DNA

Ggnbp2 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details