Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse VSIG4 (C-6His)

Source: Human Cells. MW :19.7kD. Recombinant Mouse V-Set and Ig Domain-Containing Protein 4 is produced by our Mammalian expression system and the target gene encoding His20-Pro187 is expressed with a 6His tag at the C-terminus. V-set and immunoglobulin domain containing 4 (VSIG4) is a type I transmembrane glycoprotein that is a B7 family-related protein and an Ig superfamily member. Mouse VSIG4 is synthesized as a 280 amino acid (aa) precursor that contains a signal sequence, an IgV-type immunological domain (aa 36-115), one potential N-linked glycosylation site, and a single transmembrane domain. The IgV domain of mouse VSIG4 shares 86% and 80% aa sequence identity with the IgV domains of rat and human VSIG4, respectively. VSIG4 functions as a negative regulator of mouse as well as human T cell activation, and may be involved in the maintenance of peripheral T cell tolerance and/or unresponsiveness. VSIG4 acts as a macrophage complement receptor by binding complement fragments C3b and iC3b. VSIG4 binding to C3b inhibits complement activation through the alternative pathway, making it a potent suppressor of established inflammation.

Product Specifications

Gene Name

Vsig4

Gene ID

278180

UniProt

F6TUL9

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

HPTLKTPESVTGTWKGDVKIQCIYDPLRGYRQVLVKWLVRHGSDSVTIFLRDSTGDHIQQAKYRGRLKVSHKVPGDVSLQINTLQMDDRNHYTCEVTWQTPDGNQVIRDKIIELRVRKYNPPRINTEAPTTLHSSLEATTIMSSTSDLTTNGTGKLEETIAGSGRNLPHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ncoa3 (NM_008679) Mouse Tagged ORF Clone Lentiviral Particle
MR211965L4V 200 µL

Ncoa3 (NM_008679) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ENPEP (6X11) Mouse Monoclonal antibody
E28PE1315 100 µL

ENPEP (6X11) Mouse Monoclonal antibody

Sign In for Pricing
View Details
Histone H3, Phosphorylated (Ser10) (Mitosis Marker) (Biotin)
MBS6480724-01 0.1 mL

Histone H3, Phosphorylated (Ser10) (Mitosis Marker) (Biotin)

Sign In for Pricing
View Details
Histone H3, Phosphorylated (Ser10) (Mitosis Marker) (Biotin)
MBS6480724-02 5x 0.1 mL

Histone H3, Phosphorylated (Ser10) (Mitosis Marker) (Biotin)

Sign In for Pricing
View Details
Potassium Voltage-Gated Channel Subfamily A Member 6 (KCNA6) Antibody
abx029343-01 80 µL

Potassium Voltage-Gated Channel Subfamily A Member 6 (KCNA6) Antibody

Sign In for Pricing
View Details
Potassium Voltage-Gated Channel Subfamily A Member 6 (KCNA6) Antibody
abx029343-02 400 µL

Potassium Voltage-Gated Channel Subfamily A Member 6 (KCNA6) Antibody

Sign In for Pricing
View Details