Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tryptase alpha/beta-1/TPSAB1 (C-6His)

Source: Human Cells. MW :28.8kD. Recombinant Human Tryptase alpha/beta-1 is produced by our Mammalian expression system and the target gene encoding Ile31-Pro275 is expressed with a 6His tag at the C-terminus. Tryptases are serine proteases with trypsin-like specificity. Together with chymases and Cathepsin G, tryptases are important players in mast cell mediation of inflammatory and allergic responses. Tryptase alpha/beta-1 (TPSAB1), also known as mast cell protease 7 (MCPT7), it exhibits anticoagulant activity due to its ability to degrade fibrinogen in the presence of a diverse array of protease inhibitors in plasma. The two Isoform 1 and isoform 2 are expressed in lung, stomach, spleen, heart and skin; in these tissues, isoform 1 is predominant. Isoform 2 is expressed in aorta, spleen, and breast tumor, with highest levels in the endothelial cells of some blood vessels surrounding the aorta, as well as those surrounding the tumor and low levels, if any, in mast cells. Isoform 2 cleaves large substrates, such as fibronectin, more efficiently than isoform 1, but seems less efficient toward small substrates. It may play a role in innate immunity.

Product Specifications

Gene Name

TPSAB1

Gene ID

7177

UniProt

Q15661

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

IVGGQEAPRSKWPWQVSLRVRDRYWMHFCGGSLIHPQWVLTAAHCLGPDVKDLATLRVQLREQHLYYQDQLLPVSRIIVHPQFYIIQTGADIALLELEEPVNISSRVHTVMLPPASETFPPGMPCWVTGWGDVDNDEPLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIIRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWDEGCAQPNRPGIYTRVTYYLDWIHHYVPKKPVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MMRN1 (ECM, EMILIN4, GPIA*, MMRN, Multimerin-1, EMILIN-4, Elastin Microfibril Interface Located Protein 4, Endothelial Cell Multimerin, Platelet Glycoprotein Ia*, 155kD Platelet Multimerin) (MaxLight 550)
MBS6212561-01 0.1 mL

MMRN1 (ECM, EMILIN4, GPIA*, MMRN, Multimerin-1, EMILIN-4, Elastin Microfibril Interface Located Protein 4, Endothelial Cell Multimerin, Platelet Glycoprotein Ia*, 155kD Platelet Multimerin) (MaxLight 550)

Ask
View Details
MMRN1 (ECM, EMILIN4, GPIA*, MMRN, Multimerin-1, EMILIN-4, Elastin Microfibril Interface Located Protein 4, Endothelial Cell Multimerin, Platelet Glycoprotein Ia*, 155kD Platelet Multimerin) (MaxLight 550)
MBS6212561-02 5x 0.1 mL

MMRN1 (ECM, EMILIN4, GPIA*, MMRN, Multimerin-1, EMILIN-4, Elastin Microfibril Interface Located Protein 4, Endothelial Cell Multimerin, Platelet Glycoprotein Ia*, 155kD Platelet Multimerin) (MaxLight 550)

Ask
View Details
Rabbit anti-MBD3 IHC Antibody, Affinity Purified
IHC-00693-T 2.5 µg

Rabbit anti-MBD3 IHC Antibody, Affinity Purified

Ask
View Details
AGO1 Rabbit Polyclonal Antibody
TA367041 100 µL

AGO1 Rabbit Polyclonal Antibody

Ask
View Details
Mouse Stfa2 activation kit by CRISPRa
GA204135 1 Kit

Mouse Stfa2 activation kit by CRISPRa

Ask
View Details
K63-linkage Specific Ubiquitin
MBS8534411-01 0.1 mL

K63-linkage Specific Ubiquitin

Ask
View Details