Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Basigin/CD147 (C-6His)

Source: Human Cells. MW :34.1kD. Recombinant Mouse Basigin is produced by our Mammalian expression system and the target gene encoding Ala22-Arg325 is expressed with a 6His tag at the C-terminus. Basigin/CD147 is a member of the immunoglobulin superfamily with homology to both the immunoglobulin V domain and MHC class II antigen beta-chain. This protein play important roles in variety of events including spermatogenesis, embryo implantation, neural network formation. CD147 induces the production and release of matrix metalloproteinases (MMP) in the surrounding mesenchymal cells and tumor cells, and thereby promotes invasion, metastasis, growth and survival of malignant cells. Furthermore, CD147 also serves as a receptor for extracellular cyclophilinthe and its association with integrins might be important in signal transduction. CD147 displays increased expression in many cancers, and it has been previously demonstrated to participate in cancer metastasis and progression.

Product Specifications

Gene Name

Bsg

Gene ID

12215

UniProt

P18572

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

AAGFLKAPLSQERWAGGSVVLHCEAVGSPIPEIQWWFEGNAPNDSCSQLWDGARLDRVHIHAAYRQHAASSLSVDGLTAEDTGTYECRASSDPDRNHLTRPPRVKWVRAQASVVVLEPGTIQTSVQEVNSKTQLTCSLNSSGVDIVGHRWMRGGKVLQEDTLPDLHTKYIVDADDRSGEYSCIFLPEPVGRSEINVEGPPRIKVGKKSEHSSEGELAKLVCKSDASYPPITDWFWFKTSDTGEEEAITNSTEANGKYVVVSTPEKSQLTISNLDVNVDPGTYVCNATNAQGTTRETISLRVRSRHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VPS24 ORF Vector (Human) (pORF)
50174011 1.0 µg DNA

VPS24 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
MCTS1 Antibody - N-terminal region
OAEB03056-100UG 100 µg

MCTS1 Antibody - N-terminal region

Sign In for Pricing
View Details
Estrogen Related Receptor beta Polyclonal Antibody, Cy3 Conjugated
bs-20471R-Cy3 100 µL

Estrogen Related Receptor beta Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Trichodecenin I
HY-125684 1 Each

Trichodecenin I

Sign In for Pricing
View Details
RNF87 (TRIM4) Rabbit Polyclonal Antibody
TA331688 100 µL

RNF87 (TRIM4) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rat Endoplasmic Reticulum Protein 44 (ERP44) ELISA Kit
MBS9920730-01 48 Well

Rat Endoplasmic Reticulum Protein 44 (ERP44) ELISA Kit

Sign In for Pricing
View Details