Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Basigin/CD147 (C-6His)

Source: Human Cells. MW :34.1kD. Recombinant Mouse Basigin is produced by our Mammalian expression system and the target gene encoding Ala22-Arg325 is expressed with a 6His tag at the C-terminus. Basigin/CD147 is a member of the immunoglobulin superfamily with homology to both the immunoglobulin V domain and MHC class II antigen beta-chain. This protein play important roles in variety of events including spermatogenesis, embryo implantation, neural network formation. CD147 induces the production and release of matrix metalloproteinases (MMP) in the surrounding mesenchymal cells and tumor cells, and thereby promotes invasion, metastasis, growth and survival of malignant cells. Furthermore, CD147 also serves as a receptor for extracellular cyclophilinthe and its association with integrins might be important in signal transduction. CD147 displays increased expression in many cancers, and it has been previously demonstrated to participate in cancer metastasis and progression.

Product Specifications

Gene Name

Bsg

Gene ID

12215

UniProt

P18572

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

AAGFLKAPLSQERWAGGSVVLHCEAVGSPIPEIQWWFEGNAPNDSCSQLWDGARLDRVHIHAAYRQHAASSLSVDGLTAEDTGTYECRASSDPDRNHLTRPPRVKWVRAQASVVVLEPGTIQTSVQEVNSKTQLTCSLNSSGVDIVGHRWMRGGKVLQEDTLPDLHTKYIVDADDRSGEYSCIFLPEPVGRSEINVEGPPRIKVGKKSEHSSEGELAKLVCKSDASYPPITDWFWFKTSDTGEEEAITNSTEANGKYVVVSTPEKSQLTISNLDVNVDPGTYVCNATNAQGTTRETISLRVRSRHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

GRIA2 Polyclonal Antibody
E55A02999 100 µg

GRIA2 Polyclonal Antibody

Ask
View Details
Brilliant Violet 785™ anti-human CD62P (P-Selectin)
GT08189 100 Tests

Brilliant Violet 785™ anti-human CD62P (P-Selectin)

Ask
View Details
Gm13547 (NM_001177392) Mouse Tagged ORF Clone Lentiviral Particle
MR223864L3V 200 µL

Gm13547 (NM_001177392) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details
PFDN4 (Prefoldin Subunit 4, C1, PFD4) (PE)
MBS6187555-01 0.1 mL

PFDN4 (Prefoldin Subunit 4, C1, PFD4) (PE)

Ask
View Details
PFDN4 (Prefoldin Subunit 4, C1, PFD4) (PE)
MBS6187555-02 5x 0.1 mL

PFDN4 (Prefoldin Subunit 4, C1, PFD4) (PE)

Ask
View Details