Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse V-Set and Ig Domain-Containing Protein 8/VSIG8 (C-6His)

Source: Human Cells. MW :27.6kD. Recombinant Mouse V-set and Immunoglobulin Domain-containing Protein 8 is produced by our Mammalian expression system and the target gene encoding Val22-Gly262 is expressed with a 6His tag at the C-terminus. V-set and immunoglobulin domain-containing protein 8 (VSIG8) is a single-pass type I membrane protein.The mouse VSIG8 cDNA encodes 417 amino acids (aa) including a 21 aa signal sequence, a 241 aa extracellular domain (ECD) containing 2 Ig-like V-type (immunoglobulin-like) domains, a 21 aa transmembrane domain and a 134 aa cytoplasmic domain. The function of VSIG8 is not clear.

Product Specifications

Gene Name

Vsig8

Gene ID

240916

UniProt

Q6P3A4

Components

Supplied as a 0.2 μm filtered solution of PBS, pH7.4, 10% Glycerol.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

VRINGDGQEVMYLAEGDNVRLGCPYLLDPEDLGTNSLDIEWMQVNSEPSHRENVFLTYQDKRIGHGNLPHLQQRVRFAASDPSQYDASINLMNLQVSDTATYECRVKKTTMATRKVIVTVQARPAVPMCWTEGHMSKGNDVVLKCFANGGSQPLSYKWAKISGHSHPYRAGAYHSQHSFHSELSYQESFHSTINQGLGNGDLLLKGINADDDGLYQCTVANHVGYSVCVVEVKVSDSQRVGHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PCDHB6 shRNA (h) Lentiviral Particles
sc-91988-V 200 µL

PCDHB6 shRNA (h) Lentiviral Particles

Ask
View Details
PTFE Stirrer Bar Square 25 x 5.5mm
STI4062 1 Each

PTFE Stirrer Bar Square 25 x 5.5mm

Ask
View Details
MLN2480 (BIIB-024) 100mg
A11240-100 100 mg

MLN2480 (BIIB-024) 100mg

Ask
View Details
RASGEF1A Antibody, Biotin Conjugated
MBS7134853-01 0.05 mL

RASGEF1A Antibody, Biotin Conjugated

Ask
View Details
RASGEF1A Antibody, Biotin Conjugated
MBS7134853-02 0.1 mL

RASGEF1A Antibody, Biotin Conjugated

Ask
View Details
RASGEF1A Antibody, Biotin Conjugated
MBS7134853-03 5x 0.1 mL

RASGEF1A Antibody, Biotin Conjugated

Ask
View Details