Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Signal-Regulatory Protein a-1/SIRPA/CD172a (C-MIgG2a)

Source: Human cells. MW :65.1kD. Recombinant Mouse Signal-Regulatory Protein alpha 1 is produced by our Mammalian expression system and the target gene encoding Lys32-Asn372 is expressed with a MIgG2a tag at the C-terminus. SIRPa is a type I transmembrane glycoprotein.It contains two Ig-like C1-type domains and one Ig-like V-type domain. Mouse SIRP alpha ECD shares 61%, 75%, 62%, 61%, and 59% aa sequence identity with human, rat, equine, bovine, and porcine SIRP alpha, respectively.SIRPa can express in various tissues, mainly on brain and myeloid cells, including macrophages, neutrophils, dendritic and Langerhans cells. It also can detect in neurons, smooth muscle and endothelial cells. SIRPA is an immunoglobulin-like cell surface receptor for CD47. SIRPa acts as docking protein and induces translocation of PTPN6, PTPN11 and other binding partners from the cytosol to the plasma membrane. SIRPa shows adhesion of cerebellar neurons, neurite outgrowth and glial cell attachment. SIRPa engagement generally produces a negative regulatory signal; it may mediate negative regulation of phagocytosis, mast cell activation and dendritic cell activation.

Product Specifications

Gene Name

Sirpa

Gene ID

19261

UniProt

Q6P6I8

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

KELKVTQPEKSVSVAAGDSTVLNCTLTSLLPVGPIRWYRGVGPSRLLIYSFAGEYVPRIRNVSDTTKRNNMDFSIRISNVTPADAGIYYCVKFQKGSSEPDTEIQSGGGTEVYVLAKPSPPEVSGPADRGIPDQKVNFTCKSHGFSPRNITLKWFKDGQELHPLETTVNPSGKNVSYNISSTVRVVLNSMDVNSKVICEVAHITLDRSPLRGIANLSNFIRVSPTVKVTQQSPTSMNQVNLTCRAERFYPEDLQLIWLENGNVSRNDTPKNLTKNTDGTYNYTSLFLVNSSAHREDVVFTCQVKHDQQPAITRNHTVLGFAHSSDQGSMQTFPDNNATHNWNIEGRMDPEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK
More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse 4930524B15Rik (NM_026262) AAV Particle
MR214186A1V 250 µL

Mouse 4930524B15Rik (NM_026262) AAV Particle

Sign In for Pricing
View Details
Mouse Monoclonal CD1 Antibody (76-7-4) [DyLight 755]
NBP1-28221IR 0.25 mL

Mouse Monoclonal CD1 Antibody (76-7-4) [DyLight 755]

Sign In for Pricing
View Details
Synaptophysin Blocking Peptide
abx063326-01 1 mg

Synaptophysin Blocking Peptide

Sign In for Pricing
View Details
Synaptophysin Blocking Peptide
abx063326-02 5 mg

Synaptophysin Blocking Peptide

Sign In for Pricing
View Details
FOXD4L2 Human shRNA Plasmid Kit (Locus ID 100036519)
TL321040 1 Kit

FOXD4L2 Human shRNA Plasmid Kit (Locus ID 100036519)

Sign In for Pricing
View Details
LGALS7 (Lectin, Galactoside-Binding, Soluble, 7, GAL7, LGALS7A) (MaxLight 405) discontinued
248145-ML405 100 µL

LGALS7 (Lectin, Galactoside-Binding, Soluble, 7, GAL7, LGALS7A) (MaxLight 405) discontinued

Sign In for Pricing
View Details