Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Signal-Regulatory Protein a-1/SIRPA/CD172a (C-MIgG2a)

Source: Human cells. MW :65.1kD. Recombinant Mouse Signal-Regulatory Protein alpha 1 is produced by our Mammalian expression system and the target gene encoding Lys32-Asn372 is expressed with a MIgG2a tag at the C-terminus. SIRPa is a type I transmembrane glycoprotein.It contains two Ig-like C1-type domains and one Ig-like V-type domain. Mouse SIRP alpha ECD shares 61%, 75%, 62%, 61%, and 59% aa sequence identity with human, rat, equine, bovine, and porcine SIRP alpha, respectively.SIRPa can express in various tissues, mainly on brain and myeloid cells, including macrophages, neutrophils, dendritic and Langerhans cells. It also can detect in neurons, smooth muscle and endothelial cells. SIRPA is an immunoglobulin-like cell surface receptor for CD47. SIRPa acts as docking protein and induces translocation of PTPN6, PTPN11 and other binding partners from the cytosol to the plasma membrane. SIRPa shows adhesion of cerebellar neurons, neurite outgrowth and glial cell attachment. SIRPa engagement generally produces a negative regulatory signal; it may mediate negative regulation of phagocytosis, mast cell activation and dendritic cell activation.

Product Specifications

Gene Name

Sirpa

Gene ID

19261

UniProt

Q6P6I8

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

KELKVTQPEKSVSVAAGDSTVLNCTLTSLLPVGPIRWYRGVGPSRLLIYSFAGEYVPRIRNVSDTTKRNNMDFSIRISNVTPADAGIYYCVKFQKGSSEPDTEIQSGGGTEVYVLAKPSPPEVSGPADRGIPDQKVNFTCKSHGFSPRNITLKWFKDGQELHPLETTVNPSGKNVSYNISSTVRVVLNSMDVNSKVICEVAHITLDRSPLRGIANLSNFIRVSPTVKVTQQSPTSMNQVNLTCRAERFYPEDLQLIWLENGNVSRNDTPKNLTKNTDGTYNYTSLFLVNSSAHREDVVFTCQVKHDQQPAITRNHTVLGFAHSSDQGSMQTFPDNNATHNWNIEGRMDPEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

FNTB (Protein Farnesyltransferase Subunit beta, FTase-beta, CAAX Farnesyltransferase Subunit beta, RAS Proteins Prenyltransferase Subunit beta) (FITC)
MBS6147247-01 0.1 mL

FNTB (Protein Farnesyltransferase Subunit beta, FTase-beta, CAAX Farnesyltransferase Subunit beta, RAS Proteins Prenyltransferase Subunit beta) (FITC)

Ask
View Details
FNTB (Protein Farnesyltransferase Subunit beta, FTase-beta, CAAX Farnesyltransferase Subunit beta, RAS Proteins Prenyltransferase Subunit beta) (FITC)
MBS6147247-02 5x 0.1 mL

FNTB (Protein Farnesyltransferase Subunit beta, FTase-beta, CAAX Farnesyltransferase Subunit beta, RAS Proteins Prenyltransferase Subunit beta) (FITC)

Ask
View Details
CCT8 Human Pre-designed siRNA Set A
HY-RS02185 1 Set

CCT8 Human Pre-designed siRNA Set A

Ask
View Details
Anti-C5orf24 antibody
PAab01119 100 µg

Anti-C5orf24 antibody

Ask
View Details
TR13C Polyclonal Antibody
ABP60746-01 30 µL

TR13C Polyclonal Antibody

Ask
View Details
TR13C Polyclonal Antibody
ABP60746-02 100 µL

TR13C Polyclonal Antibody

Ask
View Details