Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Signal-Regulatory Protein a-1/SIRPA/CD172a (C-Fc)

Source: Human cells. MW :65.1kD. Recombinant Mouse Signal-Regulatory Protein alpha 1 is produced by our Mammalian expression system and the target gene encoding Lys32-Asn372 is expressed with a Fc tag at the C-terminus. Mouse Signal Regulatory Protein a (SIRPa) is a type I transmembrane glycoprotein.It contains two Ig-like C1-type domains and one Ig-like V-type domain. Mouse SIRP alpha ECD shares 61%, 75%, 62%, 61%, and 59% aa sequence identity with human, rat, equine, bovine, and porcine SIRP alpha, respectively.SIRPa can express in various tissues, mainly on brain and myeloid cells, including macrophages, neutrophils, dendritic and Langerhans cells. It also can detect in neurons, smooth muscle and endothelial cells. SIRPA is an immunoglobulin-like cell surface receptor for CD47. SIRPa acts as docking protein and induces translocation of PTPN6, PTPN11 and other binding partners from the cytosol to the plasma membrane. SIRPa shows adhesion of cerebellar neurons, neurite outgrowth and glial cell attachment. SIRPa engagement generally produces a negative regulatory signal; it may mediate negative regulation of phagocytosis, mast cell activation and dendritic cell activation

Product Specifications

Gene Name

Sirpa

Gene ID

19261

UniProt

Q6P6I8

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

KELKVTQPEKSVSVAAGDSTVLNCTLTSLLPVGPIRWYRGVGPSRLLIYSFAGEYVPRIRNVSDTTKRNNMDFSIRISNVTPADAGIYYCVKFQKGSSEPDTEIQSGGGTEVYVLAKPSPPEVSGPADRGIPDQKVNFTCKSHGFSPRNITLKWFKDGQELHPLETTVNPSGKNVSYNISSTVRVVLNSMDVNSKVICEVAHITLDRSPLRGIANLSNFIRVSPTVKVTQQSPTSMNQVNLTCRAERFYPEDLQLIWLENGNVSRNDTPKNLTKNTDGTYNYTSLFLVNSSAHREDVVFTCQVKHDQQPAITRNHTVLGFAHSSDQGSMQTFPDNNATHNWNVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
More Discoveries

Explore Other Products

Browse additional items from our catalog

pBABE-puro-ELF3-flag
AX0010006 1 Each

pBABE-puro-ELF3-flag

Sign In for Pricing
View Details
SNAPC4 (Small Nuclear RNA Activating Complex, Polypeptide 4, 190kD, OTTHUMP00000022583, FLJ13451, PTFalpha, SNAP190) (FITC)
MBS6150857-01 0.1 mL

SNAPC4 (Small Nuclear RNA Activating Complex, Polypeptide 4, 190kD, OTTHUMP00000022583, FLJ13451, PTFalpha, SNAP190) (FITC)

Sign In for Pricing
View Details
SNAPC4 (Small Nuclear RNA Activating Complex, Polypeptide 4, 190kD, OTTHUMP00000022583, FLJ13451, PTFalpha, SNAP190) (FITC)
MBS6150857-02 5x 0.1 mL

SNAPC4 (Small Nuclear RNA Activating Complex, Polypeptide 4, 190kD, OTTHUMP00000022583, FLJ13451, PTFalpha, SNAP190) (FITC)

Sign In for Pricing
View Details
Mouse Monoclonal ZNF286 Antibody (OTI7D2) [DyLight 550]
NBP2-74935R 0.1 mL

Mouse Monoclonal ZNF286 Antibody (OTI7D2) [DyLight 550]

Sign In for Pricing
View Details
Mettl22 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4273704 1.0 µg DNA

Mettl22 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Anti-Hu CD107a Purified Azide Free
MBS1800670-01 0.1 mg

Anti-Hu CD107a Purified Azide Free

Sign In for Pricing
View Details