Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit B7-1/CD80 (C-6His)

Source: Human cells. MW :24.5kD. Recombinant Rabbit T-lymphocyte Activation Antigen CD82 is produced by our Mammalian expression system and the target gene encoding Gly33-Gln241 is expressed with a 6His tag at the C-terminus. Cluster of Differentiation 80, also called B7-1, is a member of cell surface immunoglobulin superfamily which plays key, yet distinct roles in the activation of T cells. B7-1/CD80 and B7-2/CD86, together with their receptors CD28 and CTLA4, constitute one of the dominant co-stimulatory pathways that regulate T- and B- cell responses. CD80 is mostly expressed on the surface of antigen-presenting cells including activated B cells, macrophages and dendritic cells. Although both CTLA-4 and CD28 can bind to the same ligands, CTLA-4 binds to B7-1 and B7-2 with a 20-100 fold higher affinity than CD28 and is involved in the down-regulation of the immune response.

Product Specifications

Gene Name

CD80

Gene ID

100009377

UniProt

P42070

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GISQVTKSVKEMAALSCDYNISIDELARMRIYWQKDQQMVLSIISGQVEVWPEYKNRTFPDIINNLSLMILALRLSDKGTYTCVVQKNENGSFRREHLTSVTLSIRADFPVPSITDIGHPDPNVKRIRCSASGGFPEPRLAWMEDGEELNAVNTTVDQDLDTELYSVSSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPIDQHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

BAF53b (ACTL6B) Human qPCR Primer Pair (NM_016188)
HP212034 200 Reactions

BAF53b (ACTL6B) Human qPCR Primer Pair (NM_016188)

Ask
View Details
Rabbit Polyclonal MPHOSPH6 Antibody
NBP1-82626 0.1 mL

Rabbit Polyclonal MPHOSPH6 Antibody

Ask
View Details
Anti-Thyroid-globulin Antibody (ATGA) Human ELISA Kit
B5744 96 Tests

Anti-Thyroid-globulin Antibody (ATGA) Human ELISA Kit

Ask
View Details
ITGA11 siRNA (Human)
CRH7780-01 15 nmol

ITGA11 siRNA (Human)

Ask
View Details
ITGA11 siRNA (Human)
CRH7780-02 30 nmol

ITGA11 siRNA (Human)

Ask
View Details
SFN, ID (SFN, HME1, 14-3-3 protein sigma, Epithelial cell marker protein 1, Stratifin) (PE)
MBS6346613-01 0.2 mL

SFN, ID (SFN, HME1, 14-3-3 protein sigma, Epithelial cell marker protein 1, Stratifin) (PE)

Ask
View Details