Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse B7-1/CD80 (C-6His)

Source: Human cells. MW :24.6kD. Recombinant Mouse T-lymphocyte Activation Antigen CD80 is produced by our Mammalian expression system and the target gene encoding Val38-Asn246 is expressed with a 6His tag at the C-terminus. Cluster of Differentiation 80, also called B7-1, is a member of cell surface immunoglobulin superfamily which plays key, yet distinct roles in the activation of T cells. Mouse CD80 consists of an extracellular domain (ECD) with twoimmunoglobulin-like domains, transmembrane segment, and cytoplasmic domain. B7-1/CD80 and B7-2/CD86, together with their receptors CD28 and CTLA4, constitute one of the dominant co-stimulatory pathways that regulate T- and B- cell responses. CD80 is mostly expressed on the surface of antigen-presenting cells including activated B cells, macrophages and dendritic cells. Although both CTLA-4 and CD28 can bind to the same ligands, CTLA-4 binds to B7-1 and B7-2 with a 20-100 fold higher affinity than CD28 and is involved in the down-regulation of the immune response.

Product Specifications

Gene Name

Cd80

Gene ID

12519

UniProt

Q00609

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

VDEQLSKSVKDKVLLPCRYNSPHEDESEDRIYWQKHDKVVLSVIAGKLKVWPEYKNRTLYDNTTYSLIILGLVLSDRGTYSCVVQKKERGTYEVKHLALVKLSIKADFSTPNITESGNPSADTKRITCFASGGFPKPRFSWLENGRELPGINTTISQDPESELYTISSQLDFNTTRNHTIKCLIKYGDAHVSEDFTWEKPPEDPPDSKNHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

BYSL (NM_004053) Human Recombinant Protein
TP308675L 1 mg

BYSL (NM_004053) Human Recombinant Protein

Ask
View Details
NFU1 Human shRNA Plasmid Kit (Locus ID 27247)
TR312452 1 Kit

NFU1 Human shRNA Plasmid Kit (Locus ID 27247)

Ask
View Details
Rat CTXII (Cross Linked C-telopeptide of Type II Collagen) ELISA Kit
E-EL-R2554-01 24 Tests

Rat CTXII (Cross Linked C-telopeptide of Type II Collagen) ELISA Kit

Ask
View Details
Rat CTXII (Cross Linked C-telopeptide of Type II Collagen) ELISA Kit
E-EL-R2554-02 48 Tests

Rat CTXII (Cross Linked C-telopeptide of Type II Collagen) ELISA Kit

Ask
View Details
Rat CTXII (Cross Linked C-telopeptide of Type II Collagen) ELISA Kit
E-EL-R2554-03 96 Tests

Rat CTXII (Cross Linked C-telopeptide of Type II Collagen) ELISA Kit

Ask
View Details
L-Lysine hydrate
281360-01 50 g

L-Lysine hydrate

Ask
View Details