Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cynomolgus B7-1/CD80 (C-6His)

Source: E. coli. MW :24.7kD. Recombinant Cynomolgus monkey T-lymphocyte Activation Antigen CD80 is produced by our Mammalian expression system and the target gene encoding Val35-Asn242 is expressed with a 6His tag at the C-terminus. Cynomolgus Cluster of Differentiation 80, also called B7-1, is a member of cell surface immunoglobulin superfamily.It is expressed on the surface of antigen-presenting cells including activated B cells, macrophages and dendritic cells.CD80 plays key, yet distinct roles in the activation of T cells. B7-1/CD80 and B7-2/CD86, together with their receptors CD28 and CTLA4, constitute one of the dominant co-stimulatory pathways that regulate T- and B- cell responses. CD80 is mostly expressed on the surface of antigen-presenting cells including activated B cells, macrophages and dendritic cells. Although both CTLA-4 and CD28 can bind to the same ligands, CTLA-4 binds to B7-1 and B7-2 with a 20-100 fold higher affinity than CD28 and is involved in the down-regulation of the immune response. CD80 is thus regarded as promising therapeutic targets for autoimmune diseases and various carcinomas.

Product Specifications

Gene Name

CD80

Gene ID

732518

UniProt

G7MKE2

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

VIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVMLSVKADFPTPSITDFEIPPSNIRRIICSTSGGFPEPHLSWLENGEELNAISTTVSQDPETELYTVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTPKQEHFPDNHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Monoclonal CD5 Antibody (C5/8117R) [Alexa Fluor 700]
NBP3-20764AF700 0.1 mL

Rabbit Monoclonal CD5 Antibody (C5/8117R) [Alexa Fluor 700]

Ask
View Details
CLS-PEG8-NH2
MD095005-8 100 mg

CLS-PEG8-NH2

Ask
View Details
Recombinant Acidianus bottle-shaped virus Uncharacterized protein ORF53b (ORF53b), partial
MBS1128413-01 0.5 mg (E-Coli)

Recombinant Acidianus bottle-shaped virus Uncharacterized protein ORF53b (ORF53b), partial

Ask
View Details
Recombinant Acidianus bottle-shaped virus Uncharacterized protein ORF53b (ORF53b), partial
MBS1128413-02 0.05 mg (Baculovirus)

Recombinant Acidianus bottle-shaped virus Uncharacterized protein ORF53b (ORF53b), partial

Ask
View Details
Recombinant Acidianus bottle-shaped virus Uncharacterized protein ORF53b (ORF53b), partial
MBS1128413-03 0.5 mg (Yeast)

Recombinant Acidianus bottle-shaped virus Uncharacterized protein ORF53b (ORF53b), partial

Ask
View Details
Recombinant Acidianus bottle-shaped virus Uncharacterized protein ORF53b (ORF53b), partial
MBS1128413-04 0.05 mg (Mammalian-Cell)

Recombinant Acidianus bottle-shaped virus Uncharacterized protein ORF53b (ORF53b), partial

Ask
View Details