Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Fas/TNFRSF6/CD95 (C-6His)

Source: Human Cells. MW :17.4kD. Recombinant Mouse Apoptosis-mediating Surface Antigen FAS is produced by our Mammalian expression system and the target gene encoding Gln22-Arg169 is expressed with a 6His tag at the C-terminus. Mouse Apoptosis-mediating surface antigen FAS (Fas) belongs to the death receptor subfamily of the TNF receptor superfamily and is designated TNFRSF6. Mouse Fas contains 1 death domain and 3 TNFR-Cys repeats. It detected in various tissues including thymus, liver, lung, heart, and adult ovary. As a receptor for TNFSF6/FASLG, The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases mediating apoptosis. FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both.

Product Specifications

Gene Name

Fas

Gene ID

14102

UniProt

P25446

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QGTNSISESLKLRRRVRETDKNCSEGLYQGGPFCCQPCQPGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCDEEHGLEVETNCTLTQNTKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRKQSPRNRHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

RGD1310773 Adenovirus (Rat)
39115056 1.0 mL

RGD1310773 Adenovirus (Rat)

Ask
View Details
Mouse Creatine Kinase B-Type (CKB) ELISA Kit
MBS9907278-01 48 Well

Mouse Creatine Kinase B-Type (CKB) ELISA Kit

Ask
View Details
Mouse Creatine Kinase B-Type (CKB) ELISA Kit
MBS9907278-02 96 Well

Mouse Creatine Kinase B-Type (CKB) ELISA Kit

Ask
View Details
Mouse Creatine Kinase B-Type (CKB) ELISA Kit
MBS9907278-03 5x 96 Well

Mouse Creatine Kinase B-Type (CKB) ELISA Kit

Ask
View Details
Mouse Creatine Kinase B-Type (CKB) ELISA Kit
MBS9907278-04 10x 96 Well

Mouse Creatine Kinase B-Type (CKB) ELISA Kit

Ask
View Details
Endothelin 1 (Endothelin-1, EDN1, ET1, ET-1, HDLCQ7, Preproendothelin-1, PPET1) (PE)
MBS6157640-01 0.1 mL

Endothelin 1 (Endothelin-1, EDN1, ET1, ET-1, HDLCQ7, Preproendothelin-1, PPET1) (PE)

Ask
View Details