Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human NKG2-D type II Integral Membrane Protein/NKG2D/CD314 (N-6His)

Source: Human Cells. MW :16.9kD. Recombinant Human NKG2-D type II Integral Membrane Protein is produced by our expression system and the target gene encoding Phe78-Val216 is expressed with a 6His tag at the N-terminus. NKG2-D type II integral membrane protein (NKG2D) is a type II transmembrane glycoprotein which belongs to the CD94/NKG2 family. NKG2D is expressed on natural killer (NK) cells, CD8+ alpha-beta and gamma-delta T-cells. As an activating and costimulatory receptor, it involved in immunosurveillance upon binding to various cellular stress-inducible ligands displayed at the surface of autologous tumor cells and virus-infected cells. It provides both stimulatory and costimulatory innate immune responses on activated killer (NK) cells, leading to cytotoxic activity. It stimulates perforin-mediated elimination of ligand-expressing tumor cells. Signaling involves calcium influx, culminating in the expression of TNF-alpha. NKG2D participates in NK cell-mediated bone marrow graft rejection and survival of NK cells. It Binds to ligands belonging to various subfamilies of MHC class I-related glycoproteins including MICA, MICB, RAET1E, RAET1G, ULBP1, ULBP2, ULBP3 (ULBP2>ULBP1>ULBP3) and ULBP4.

Product Specifications

Gene Name

KLRK1

Gene ID

100528032

UniProt

P26718

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

HHHHHHFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CNKSR1 Peptide - middle region
MBS3240437-01 0.1 mg

CNKSR1 Peptide - middle region

Ask
View Details
CNKSR1 Peptide - middle region
MBS3240437-02 5x 0.1 mg

CNKSR1 Peptide - middle region

Ask
View Details
FPRL2 (Formyl Peptide Receptor-like 2, FMLP-related Receptor II, FMLP-R-II, N-formyl Peptide Receptor 3, FPR3, FPRH1) (MaxLight 550) discontinued
F6011-01A-ML550 100 µL

FPRL2 (Formyl Peptide Receptor-like 2, FMLP-related Receptor II, FMLP-R-II, N-formyl Peptide Receptor 3, FPR3, FPRH1) (MaxLight 550) discontinued

Ask
View Details
Rabbit Polyclonal Teneurin-1 Antibody [Alexa Fluor 594]
NBP2-41315AF594 0.1 mL

Rabbit Polyclonal Teneurin-1 Antibody [Alexa Fluor 594]

Ask
View Details
Mouse Pcdha3 Pre-designed siRNA Set A
SI110196A 1 Each

Mouse Pcdha3 Pre-designed siRNA Set A

Ask
View Details
PerCP/Cyanine5.5 anti-human CD371 (CLEC12A)
GT13265 25 Tests

PerCP/Cyanine5.5 anti-human CD371 (CLEC12A)

Ask
View Details