Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat B7-2/CD86 (C-6His)

Source: Human cells. MW :25.9kD. Recombinant Rat T-lymphocyte Activation Antigen CD86 is produced by our Mammalian expression system and the target gene encoding Vla29-Lys247 is expressed with a 6His tag at the C-terminus. T-lymphocyte activation antigen CD86 (B7-2) is a glycosylated protein in the B7 family. B7 family members are transmembrane cell surface molecules that play important roles in immune activation and the maintenance of immune tolerance. It is highly expressed on activated antigen presenting cells. CD86 involved in the costimulatory signal essential for T-lymphocyte proliferation and interleukin-2 production, by binding CD28 or CTLA-4. It may play a critical role in the early events of T-cell activation and costimulation of naive T-cells, such as deciding between immunity and anergy that is made by T-cells within 24 hours after activation. It is expressed by activated B-lymphocytes and monocytes and promoted by MARCH8 and results in endocytosis and lysosomal degradation.

Product Specifications

Gene Name

Cd86

Gene ID

56822

UniProt

O35531

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

VPVKRQAYFNSTAYLPCPFTKAQNISPSELVVFWQDRKKSVLYEHYLGAEKLDNVNAKYLGRTSFDRDNQALRLHNVQIKDTGLYDCFIQQKTPTGSIILQQWETELSVIANFSEPEIEEAQNETRNTGINLTCSSKQGYPKPTKMYFLITNSTNEYGDNMQISQDNVTKLFSVSISLSLPFPDGVYNMTIVCILETESMNISSKPHNMVFSQPQFDRKHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

rno-miR-185-5p Primers
MPR00442 150 µL / 10 µM

rno-miR-185-5p Primers

Ask
View Details
PADI4 Antibody
DF6685-01 100 µL

PADI4 Antibody

Ask
View Details
PADI4 Antibody
DF6685-02 200 µL

PADI4 Antibody

Ask
View Details
Flufenacet ESA-d7 Sodium Salt
450140-01 1 mg

Flufenacet ESA-d7 Sodium Salt

Ask
View Details
Flufenacet ESA-d7 Sodium Salt
450140-02 2.5 mg

Flufenacet ESA-d7 Sodium Salt

Ask
View Details
Mouse Monoclonal CD163 Antibody (R20) [CoraFluor 1]
FAB16072CL1 0.1 mL

Mouse Monoclonal CD163 Antibody (R20) [CoraFluor 1]

Ask
View Details