Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cynomolgus B7-2/CD86 (C-6His)

Source: E. coli. MW :25.7kD. Recombinant Cynomolgus monkey T-lymphocyte Activation Antigen CD86 is produced by our Mammalian expression system and the target gene encoding Tyr31-Pro247 is expressed with a 6His tag at the C-terminus. T-lymphocyte activation antigen CD86 (B7-2) is a glycosylated protein in the B7 family. B7 family members are transmembrane cell surface molecules that play important roles in immune activation and the maintenance of immune tolerance. It is highly expressed on activated antigen presenting cells. CD86 involved in the costimulatory signal essential for T-lymphocyte proliferation and interleukin-2 production, by binding CD28 or CTLA-4. It may play a critical role in the early events of T-cell activation and costimulation of naive T-cells, such as deciding between immunity and anergy that is made by T-cells within 24 hours after activation. It is expressed by activated B-lymphocytes and monocytes and promoted by MARCH8 and results in endocytosis and lysosomal degradation.

Product Specifications

Gene Name

CD86

UniProt

H9ZFI8

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

YFNETADLPCQFANSQNRSLSELVVFWQNQENLVLNEVYLGKEKFDSVHSKYMGRTSFDPESWTLRLHNLQIKDKGLYQCIIHHKRPTGMIRIHQMNSELSVLANFSQPEIVPISNITENMYINLTCSSIHGYPEPEKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCVLETDKTQLLSSPFSIELEDPQPPPDHIPHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Misoprostol
164986 25 mg

Misoprostol

Ask
View Details
BPIFA1 (BPI Fold-containing Family A Member 1, Lung-specific Protein X, Nasopharyngeal Carcinoma-Related Protein, Palate Lung and Nasal Epithelium Clone Protein, Secretory Protein in Upper Respiratory Tracts, Short PLUNC1, SPLUNC1, Tracheal Epithelium-enriched Protein) discontinued
359893-01 50 µL

BPIFA1 (BPI Fold-containing Family A Member 1, Lung-specific Protein X, Nasopharyngeal Carcinoma-Related Protein, Palate Lung and Nasal Epithelium Clone Protein, Secretory Protein in Upper Respiratory Tracts, Short PLUNC1, SPLUNC1, Tracheal Epithelium-enriched Protein) discontinued

Ask
View Details
BPIFA1 (BPI Fold-containing Family A Member 1, Lung-specific Protein X, Nasopharyngeal Carcinoma-Related Protein, Palate Lung and Nasal Epithelium Clone Protein, Secretory Protein in Upper Respiratory Tracts, Short PLUNC1, SPLUNC1, Tracheal Epithelium-enriched Protein) discontinued
359893-02 100 µL

BPIFA1 (BPI Fold-containing Family A Member 1, Lung-specific Protein X, Nasopharyngeal Carcinoma-Related Protein, Palate Lung and Nasal Epithelium Clone Protein, Secretory Protein in Upper Respiratory Tracts, Short PLUNC1, SPLUNC1, Tracheal Epithelium-enriched Protein) discontinued

Ask
View Details
Anti-BCR Polyclonal Antibody
HY023014-01 50 µg

Anti-BCR Polyclonal Antibody

Ask
View Details
Anti-BCR Polyclonal Antibody
HY023014-02 100 µg

Anti-BCR Polyclonal Antibody

Ask
View Details
SOCS1 Antibody
AF5378-01 100 µL

SOCS1 Antibody

Ask
View Details