Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-3/IL-3 (C-6His)

Source: Human cells. MW :16.5kD. Recombinant Mouse Interleukin-3 is produced by our Mammalian expression system and the target gene encoding Ala27-Cys166 is expressed with a 6His tag at the C-terminus. Interleukin 3 is a pleiotropic factor produced primarily by activated T cells that can stimulate the proliferation and differentiation of pluripotent hematopoietic stem cells as well as various lineage committed progenitors. In addition, IL-3 also affects the functional activity of mature mast cells, basophils, eosinophils and macrophages.Because of its multiple functions and targets, it was originally studied under different names, including mast cell growth factor P-cell stimulating factor, burst promoting activity, multi-colony stimulating factor, thy-1 inducing factor and WEHI-3 growth factor. In addition to activated T cells, other cell types such as human thymic epithelial cells, activated mouse mast cells, mouse keratinocytes and neurons/astrocytes can also produce IL-3. IL-3 exerts its biological activities through binding to specific cell surface receptors. The high affinity receptor responsible for IL-3. signaling is composed of a and betasubunits. IL-3 is capable of supporting the proliferation of abroad range of hematopoietic cell types. It is involved in avariety of cell activities such as cell growth, differentiation and apoptosis. IL-3 has been shown to also possess neurotrophic activity, and it may be associated with neurologic disorders.

Product Specifications

Gene Name

Il3

Gene ID

16187

UniProt

P01586

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

ASISGRDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVECHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Albumin (ALB) Bovine discontinued
153419-01 10 µg

Albumin (ALB) Bovine discontinued

Ask
View Details
Albumin (ALB) Bovine discontinued
153419-02 50 µg

Albumin (ALB) Bovine discontinued

Ask
View Details
GNGT2 polyclonal antibody
BS75555-01 50 µL

GNGT2 polyclonal antibody

Ask
View Details
GNGT2 polyclonal antibody
BS75555-02 100 µL

GNGT2 polyclonal antibody

Ask
View Details
RRP12 Polyclonal Antibody
MBS8567997-01 0.1 mL

RRP12 Polyclonal Antibody

Ask
View Details
RRP12 Polyclonal Antibody
MBS8567997-02 0.1 mL (AF405L)

RRP12 Polyclonal Antibody

Ask
View Details