Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse IL-1 Receptor Type 1/IL-1R-1 (C-Fc)

Source: Human Cells. MW :64kD. Recombinant Mouse Interleukin-1 receptor type 1 is produced by our Mammalian expression system and the target gene encoding Leu20-Lys338 is expressed with a Fc tag at the C-terminus. Mouse Interleukin-1 receptor type 1/IL-1 RI is a cytokine receptor that belongs to the interleukin-1 receptor family. This protein is a receptor for interleukin 1 alpha (IL1A), interleukin 1 beta (IL1B), and interleukin 1 receptor antagonist (IL1RA) . It is an important mediator involved in many cytokine induced immune and inflammatory responses. An IL1 receptor accessory protein that can heterodimerize with the Type I receptor in the presence of IL1a or IL1 betabut not IL1ra, was identified. This Type I receptor complex appears to mediate all the known IL1 biological responses. The receptor Type II has a short cytoplasmic domain and does not transduce IL1 signals. In addition to the membranebound form of IL1 RII, a naturallyoccurring soluble form of IL1 RII has been described. It has been suggested that the Type II receptor, either as the membranebound or as the soluble form, serves as a decoy for IL1 and inhibits IL1 action by blocking the binding of IL1 to the signaling Type I receptor complex.

Product Specifications

Gene Name

Il1r1

Gene ID

16177

UniProt

P13504

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LEIDVCTEYPNQIVLFLSVNEIDIRKCPLTPNKMHGDTIIWYKNDSKTPISADRDSRIHQQNEHLWFVPAKVEDSGYYYCIVRNSTYCLKTKVTVTVLENDPGLCYSTQATFPQRLHIAGDGSLVCPYVSYFKDENNELPEVQWYKNCKPLLLDNVSFFGVKDKLLVRNVAEEHRGDYICRMSYTFRGKQYPVTRVIQFITIDENKRDRPVILSPRNETIEADPGSMIQLICNVTGQFSDLVYWKWNGSEIEWNDPFLAEDYQFVEHPSTKRKYTLITTLNISEVKSQFYRYPFICVVKNTNIFESAHVQLIYPVPDFKIEGRDMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

RGD1562683 (NM_001108314) Rat Tagged ORF Clone
RR208774 10 µg

RGD1562683 (NM_001108314) Rat Tagged ORF Clone

Ask
View Details
PROP1 Antibody
A32098-100UG 100 µg

PROP1 Antibody

Ask
View Details
Himic Sterilization agent k Kit (Designed for studying effects of different sterilization agents.)
TP 1003 1 Kit

Himic Sterilization agent k Kit (Designed for studying effects of different sterilization agents.)

Ask
View Details
AdmiRa-mmu-miR-7007-3p Virus
mm1742 250 µL

AdmiRa-mmu-miR-7007-3p Virus

Ask
View Details
Human MFAP1 Protein Lysate
MBS8415173-01 0.02 mg

Human MFAP1 Protein Lysate

Ask
View Details
Human MFAP1 Protein Lysate
MBS8415173-02 5x 0.02 mg

Human MFAP1 Protein Lysate

Ask
View Details