Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cytotoxic T-Lymphocyte Protein 4/CTLA-4/CD152 (C-6His)

Source: Human cells. MW :14.6kD. Recombinant Mouse Cytotoxic T-lymphocyte protein 4 is produced by our Mammalian expression system and the target gene encoding Ala37-Asp161 is expressed fused with a 6His tag at the C-terminus. Mouse Cytotoxic Tlymphocyte 4 (CTLA-4, CD152), is a type I transmembrane T cell inhibitory molecule. Within the ECD, Mouse CTLA-4 shares 68% aa sequence identity with human. CTLA4 is similar to the T cell costimulatory protein CD28 since both of the molecules bind to CD80 and CD86 on antigen-presenting cells. CTLA4 transmits an inhibitory signal to T cells, whereas CD28 transmits a stimulatory signal. Intracellular CTLA4 is also found inregulatory T cells and may play an important role in their functions. T cell activation through the T cell receptor and CD28 leads to increased expression of CTLA4. Genetic variations of CTLA4 have been associated with susceptibility to systemic lupus erythematosus (SLE), Gravesdisease (GRD), Celiac disease type3 (CELIAC3) and Hepatitis B virus infection (HBVinfection) .

Product Specifications

Gene Name

Ctla4

Gene ID

12477

UniProt

P09793

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

AIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MIR550-1 Human MicroRNA Expression Plasmid (MI0003600)
SC400528 10 µg

MIR550-1 Human MicroRNA Expression Plasmid (MI0003600)

Ask
View Details
Sheep CdtA (CdtA) ELISA Kit
MBS9345944-01 48 Well

Sheep CdtA (CdtA) ELISA Kit

Ask
View Details
Sheep CdtA (CdtA) ELISA Kit
MBS9345944-02 96 Well

Sheep CdtA (CdtA) ELISA Kit

Ask
View Details
Sheep CdtA (CdtA) ELISA Kit
MBS9345944-03 5x 96 Well

Sheep CdtA (CdtA) ELISA Kit

Ask
View Details
Sheep CdtA (CdtA) ELISA Kit
MBS9345944-04 10x 96 Well

Sheep CdtA (CdtA) ELISA Kit

Ask
View Details
Lentiviral human C9orf16 sgRNA gene knockout kit - Lentiviral human C9orf16 sgRNA gene knockout kit (100)
GTR15397657 1 Vial

Lentiviral human C9orf16 sgRNA gene knockout kit - Lentiviral human C9orf16 sgRNA gene knockout kit (100)

Ask
View Details