Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytotoxic T-Lymphocyte Protein 4/CTLA-4/CD152 (C-6His)

Source: Human cells. MW :14.3kD. Recombinant Human Cytotoxic T-lymphocyte protein 4 is produced by our Mammalian expression system and the target gene encoding Lys36-Asp161 is expressed fused with a 6His tag at the C-terminus. Cytotoxic Tlymphocyte 4 (CTLA-4, CD152), is a type I transmembrane T cell inhibitory molecule that is a member of the Ig superfamily. Human or mouse CTLA4 cDNA encodes 223 amino acids (aa) including a 35 aa signal sequence, a 126 aa extracellular domain (ECD) with one Ig-like V-type domain, a 21 aa transmembrane (TM) sequence, and a 41 aa cytoplasmic sequence.It is widely expressed with highest levels in lymphoid tissues. CD28 and CTLA-4, together with their ligands, B7-1 and B7-2, constitute one of the dominant costimulatory pathways that regulate T and B cell responses. CD28 and CTLA-4 are structurally homologous molecules that are members of the immunoglobulin (Ig) gene superfamily. CTLA4 transmits an inhibitory signal to T cells, whereas CD28 transmits a stimulatory signal. Intracellular CTLA4 is also found in regulatory T Cells and may play an important role in their functions. Tcell activation through the Tcell receptor and CD28 leads to increased expression of CTLA4.

Product Specifications

Gene Name

CTLA4

Gene ID

1493

UniProt

P16410

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

KAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Suppressor of Variegation 3-9 Homolog 2 (SUV39H2) Antibody
abx115913 100 µL

Suppressor of Variegation 3-9 Homolog 2 (SUV39H2) Antibody

Ask
View Details
Rabbit Polyclonal Purine Nucleoside Phosphorylase/PNP Antibody [mFluor Violet 500 SE]
NBP2-99935MFV500 0.1 mL

Rabbit Polyclonal Purine Nucleoside Phosphorylase/PNP Antibody [mFluor Violet 500 SE]

Ask
View Details
CASQ1 siRNA (Rat)
CRR6807-01 15 nmol

CASQ1 siRNA (Rat)

Ask
View Details
CASQ1 siRNA (Rat)
CRR6807-02 30 nmol

CASQ1 siRNA (Rat)

Ask
View Details
Rabbit anti-SEPHS1 Antibody
MBS4510217-01 0.05 mL

Rabbit anti-SEPHS1 Antibody

Ask
View Details
Rabbit anti-SEPHS1 Antibody
MBS4510217-02 0.1 mL

Rabbit anti-SEPHS1 Antibody

Ask
View Details