Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse a-2-HS-Glycoprotein//AHSG/Fetuin A (C-10His)

Source: Human Cells. MW :36.7kD. Recombinant Mouse Fetuin A is produced by our Mammalian expression system and the target gene encoding Ala19-Ile345 is expressed with a 10His tag at the N-terminus. Alpha-2-HS-glycoprotein (AHSG) is a glycoprotein that is composed of two subunits, the A and B chains, belongs to the Cystatin family of proteases inhibitors. It is highly expressed in embryonic cells and adult hepatocytes, and is expressed to a lesser extent in monocytes/macrophages. AHSG is an important circulating inhibitor of calcification in vivo, and is downregulated during the acute-phase response. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. In addition, AHSG may influence the resolution of inflammation by modulating the phagocytosis of apoptotic cells by macrophages. ASHG blocks TGF-beta-dependent signaling in osteoblastic cells.

Product Specifications

Gene Name

Ahsg

Gene ID

11625

UniProt

P29699

Components

Lyophilized from a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, pH7.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

APQGTGLGFRELACDDPEAEQVALLAVDYLNNHLLQGFKQVLNQIDKVKVWSRRPFGVVYEMEVDTLETTCHALDPTPLANCSVRQLTEHAVEGDCDFHILKQDGQFRVMHTQCHSTPDSAEDVRKLCPRCPLLTPFNDTNVVHTVNTALAAFNTQNNGTYFKLVEISRAQNVPLPVSTLVEFVIAATDCTAKEVTDPAKCNLLAEKQHGFCKANLMHNLGGEEVSVACKLFQTQPQPANANAVGPVPTANAALPADPPASVVVGPVVVPRGLSDHRTYHDLRHAFSPVASVESASGETLHSPKVGQPGAAGPVSPMCPGRIRHFKIHHHHHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aqp9 (BC024105) Mouse Tagged ORF Clone
MG201851 10 µg

Aqp9 (BC024105) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
JCHAIN Antibody
KC-1763-01 50 μL

JCHAIN Antibody

Sign In for Pricing
View Details
JCHAIN Antibody
KC-1763-02 100 µL

JCHAIN Antibody

Sign In for Pricing
View Details
JCHAIN Antibody
KC-1763-03 1 mL

JCHAIN Antibody

Sign In for Pricing
View Details
5-Iodo-2’-deoxytubercidin
TRC-I705030-50MG 50 mg

5-Iodo-2’-deoxytubercidin

Sign In for Pricing
View Details
PE Anti-Mouse CD23 Antibody[B3B4]
E-AB-F1178D-01 50 Tests

PE Anti-Mouse CD23 Antibody[B3B4]

Sign In for Pricing
View Details